PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_09733_BGI-A2_v1.0
Common NameF383_22929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 372aa    MW: 41735.5 Da    PI: 8.8901
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_09733_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32193246255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cotton_A_09733_BGI-A2_v1.0 193 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15190246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28191246IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23193246IPR006447Myb domain, plants
PfamPF002492.4E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDFFPAQPDL SLQISPPNSK PTSRGLDSRS SMSSMAKPDN CFELSFSNPR VSDSNSNHFH  60
QLLQNGSATA NCNGNLFQSY HHNQFPHHHN QLQHPLLYQH QHQHQQHQQG LGQEFGFLRP  120
IRGIPVYQNP PPPPSSPPFP FAQQPLDSSL PSSPSYLATT KIGNTSLNPF QSQGLMRSRF  180
MSRFPAKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DRAAASSGQM DAFENGSSGD TSEDMMFDIQ NPRRSEISVQ QGRSSSSNAH  300
QDKEYHGLWS NSSREAWLHG KPNDSPLNLP SLQKDMDPKC LSYERISDVS SSSLSETCSK  360
KPNLEFTLGV PH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-17194248357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17194248357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17194248357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17194248357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-17194248458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017623780.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6167e-83KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0B0MP710.0A0A0B0MP71_GOSAR; Putative transcription factor KAN2-like protein
STRINGGorai.004G182500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-76G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]