PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_09284_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 644aa    MW: 71596.8 Da    PI: 7.4539
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_09284_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.76.1e-34421475155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 kpr+rWtpeLHe+F+eav+qLGGse+AtPk il+lm+v+gLt++hvkSHLQkYR+
  Cotton_A_09284_BGI-A2_v1.0 421 KPRMRWTPELHEAFLEAVNQLGGSERATPKGILKLMNVEGLTIYHVKSHLQKYRT 475
                                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-155393IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.22354179IPR005172CRC domain
PfamPF036382.8E-115690IPR005172CRC domain
SMARTSM011148.0E-14139180IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.2E-11142177IPR005172CRC domain
PROSITE profilePS5129412.615418478IPR017930Myb domain
SuperFamilySSF466896.63E-19419475IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-31420476IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-25421475IPR006447Myb domain, plants
PfamPF002491.7E-10423474IPR001005SANT/Myb domain
PfamPF143793.5E-23508552IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MLIVITREVV YQKKWRILRK CPFFTCLEVN NLLTGLTNNP NPKNKETFPV KIQAWKHCNC  60
IRSRCVKLYC ECFAAGIYCD NCACQNCLNN PDYDDTVLDT RQQIELRNPL AFASPVVFPS  120
NDSPNVTGHG NLMNAGSPRH RRGCKCKRTK CLKKYCDCYR AEVGCSAICN CEDCDNSFGK  180
KPDIKQLGIR NLGLAAMPSS FLALTSFKDK YSTSPSSFQV SSGREVMENS VSLQESSLAP  240
SNGTLGNSSL SPSIVTDHMC ASALPHVQHS HNPAFISQSS RDLASLLPLD ASFSQSTASL  300
IHTQGNKDVS WSLDRLQMFL DLPENTPAPN QLVESSTSVL ASEDHNKKTN WQEWADDLIN  360
VVDPDWSKIL DNTNVLNPRV ELPKPSGDIS KQQPQFHQNQ LVPHGEFSSH AYPSSTAPPT  420
KPRMRWTPEL HEAFLEAVNQ LGGSERATPK GILKLMNVEG LTIYHVKSHL QKYRTARYMP  480
ETSEGTSEKR ITSIEEMKSI DLKTSIGITE ALRLQVEVQK QLHEQLEIQR NLQLRIEEQG  540
RYLQMMFEKQ KKVEDEKGGA PSSASDDLLA PLPGSKHPPC NNGKSDSEAL EQDHSRTGIG  600
PGNAGTNEDK SSSGVSTKQK MPETESTVHD ESGFSVSKRA RTEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-31421478259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017627605.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
RefseqXP_017627606.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN52e-97PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0B0MNA40.0A0A0B0MNA4_GOSAR; Myb family transcription factor APL
STRINGGorai.007G274700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-100G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]