PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_08350_BGI-A2_v1.0
Common NameF383_06149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 754aa    MW: 82270 Da    PI: 5.2601
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_08350_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.1e-16458496240
                         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                 ++k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Cotton_A_08350_BGI-A2_v1.0 458 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 496
                                 689**********************************96 PP

2TCR52.41.1e-16543581139
                         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                 ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Cotton_A_08350_BGI-A2_v1.0 543 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 581
                                 589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-18457498IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.358458583IPR005172CRC domain
PfamPF036381.0E-11460495IPR005172CRC domain
SMARTSM011142.1E-17543584IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.6E-12545581IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MDTPEKTQIS SSLSKFEDSP VFNYINSLSP IKPVKSVHVT QTFNPLSFAS LPSIFTSPHV  60
SSHKESRFLK TYTEPLKPEL SSADGTKVST NEEAGADAQE NFDQGVSLGE TSFEMPNETS  120
RIAIGLPQTL KYDCGSPDCD ATPSVIKTTC VSDTSLAIVP FVQETSEKGL SDRVEIRDTF  180
QVEQKRDTIG SEWESLISDT SDLLIFNSPN DSEAFRGVIQ KSLDPSVLIS QFSQDDINEA  240
CQTTVDLDKY KDQTEGAGDM NEMNPVNESF KVVSVTNFIS GSLTDYMETR MSAPYSFKPD  300
SNLHRGFRRR CLDFEMLAAR RKNLDGGSTT NSSTDNKLVP GKPDSDSPSC IVPGIGLHLN  360
ALAIASRDNK NMKLETLSSG TQKLSFPSLN SPCTGGAETA YESLPSASTE RESDAVENGV  420
QLAEDASQAS AYLVNEEFNQ NSPKKKRRRL EQAGEGESCK RCNCKKSKCL KLYCECFAAG  480
VYCIEPCSCQ DCFNKPIHED TVLATRKQIE SRNPLAFAPK VIRTSDSVPE VGDDLITTPA  540
SARHKRGCNC KKSNCLKKYC ECFQGGVGCS INCRCEGCKN AFGRKDGSAI METDGEPGEE  600
ETDPSEKNAL DKNFEKPDIL NNEEQNPASA LPTTPLQLCR PLVQLPFSSK SKPPRSFIAI  660
GSSSALYTGQ RYGKPSIIRP QNIIEKHFQT IAEDETPEIL RGNSSPGTGI KTSSPNSKRI  720
SPPQCELGST PGGRSGRKLI LQSIPSFPSL TPKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1646258014120Protein lin-54 homolog
5fd3_B3e-1646258014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442449PKKKRRRL
2443448KKKRRR
3445449KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017633780.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A2P5X3H90.0A0A2P5X3H9_GOSBA; Uncharacterized protein
STRINGGorai.005G044800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-152TESMIN/TSO1-like CXC 2