PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_07950_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 224aa    MW: 25433.7 Da    PI: 8.6168
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_07950_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.3e-332983155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Cotton_A_07950_BGI-A2_v1.0 29 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 83
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-322684IPR009057Homeodomain-like
PROSITE profilePS5129412.3542686IPR017930Myb domain
SuperFamilySSF466891.02E-162886IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-252984IPR006447Myb domain, plants
PfamPF002495.7E-93182IPR001005SANT/Myb domain
PfamPF143793.9E-20118163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MERLSYGGGG GGEGNYWYEN EVVMSRDQKP RLRWTADLHD RFVDAVTKLG GPDKATPKSV  60
LRLMGMKGLT LYHLKSHLQK YRLGQQTRKQ NAVDLNKVNG GTIITNSPRA DSEQRQIPVA  120
EALKNQVEVQ QTLQEQLEVE KKLQMRIDAQ GKYLQAILEK AQKRVSIDIN YCEGNGEEET  180
NFNVLNKVNC SAFQNYGGRW RENSKDVKLE VEGDSIAFDL KDQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-192982154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-192982154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-192982154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-192982154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016736748.11e-166PREDICTED: myb family transcription factor APL-like isoform X2
RefseqXP_017637279.11e-166PREDICTED: myb family transcription factor PHL11-like isoform X3
SwissprotC0SVS42e-65PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A1U8NFJ81e-165A0A1U8NFJ8_GOSHI; myb family transcription factor APL-like isoform X2
STRINGGorai.008G221900.11e-149(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2443634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.19e-53G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]