PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_07929_BGI-A2_v1.0
Common NameF383_15331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 382aa    MW: 42739.7 Da    PI: 9.1322
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_07929_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32201254255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cotton_A_07929_BGI-A2_v1.0 201 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 254
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15198254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28199254IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23201254IPR006447Myb domain, plants
PfamPF002492.5E-7202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MELFPDLSLQ ISPPNPKPTS SCRTREEDMD LGFWKRPLDS RNSISSMAKP DNCIDLSLSN  60
PRISESNSNH LQLLHNGTAN CNGNLFHAYN QNHFPYHHKH LQHPLLYQHQ QQRQQQQQQE  120
LGQELGFLRP IRGIPVYQNP PPPPFPFAQQ PLDSSLASSP SSLASNTINA SSTSLSHFQS  180
QGLMRSRFMS RFPAKRSMRA PRMRWTTTLH ARFVHAVELL GGHERATPKS VLELMDVKDL  240
TLAHVKSHLQ MYRTVKTTDR AAASSGQSDA FENGSSGDTS EDLMMDIQNP RRSEVSVQQG  300
RSSSSSNAYQ DKEYHGLWSN SSREAWLHGK PKDSAGNVPS LQKDMDPKCL SHERVSDGSS  360
SSLSGTSPKK PNLEFTLGVL PH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16202256357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16202256357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16202256357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16202256357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16202256458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431300.0AC243130.1 Gossypium raimondii clone GR__Ba0240C19-hnz, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017634640.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6168e-87KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0B0MAU30.0A0A0B0MAU3_GOSAR; Putative transcription factor KAN2-like protein
STRINGGorai.008G224400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-84G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]