PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_07771_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 312aa    MW: 35971.5 Da    PI: 8.1413
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_07771_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32143197155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 k+r+rWt++LHe+Fve+v++LGG ekAtPktil+lm+ +gLt+ hvkSHLQkYR+
  Cotton_A_07771_BGI-A2_v1.0 143 KTRIRWTQDLHEKFVECVKRLGGCEKATPKTILKLMDTQGLTIFHVKSHLQKYRT 197
                                 68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-28140198IPR009057Homeodomain-like
PROSITE profilePS5129411.363140200IPR017930Myb domain
SuperFamilySSF466891.79E-16142197IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-23143197IPR006447Myb domain, plants
PfamPF002497.0E-9147196IPR001005SANT/Myb domain
PfamPF143791.3E-19225271IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MNTKRTDSQE LARQSLGFNR NCNLQPAMEG VPQQLNPGSS SSNPIMSGFQ TPAYAFYATE  60
RLDTSFCPQH NIYSSIESIA QDEPNYDFRN TLQSLVKSQI CFDQYQKSFE RSYKFPGSNA  120
KTHFSVPSRG NQDQRAYCNK SNKTRIRWTQ DLHEKFVECV KRLGGCEKAT PKTILKLMDT  180
QGLTIFHVKS HLQKYRTARY MPEFTQDCNL ITMYAMCRVF GSGLHLTEAL QLQLDVQRRL  240
NEQLEFQRNL QLRIEEQGRR LKMMIDEQQK TNENLLKNQG VDIKPYEHDP SFSDLDSSIA  300
ETSENVLTSG PC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-24143200158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-24143200158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-24143200158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-24143200158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-24143200259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017609548.10.0PREDICTED: myb family transcription factor PHL5
TrEMBLA0A2P5WUB00.0A0A2P5WUB0_GOSBA; Uncharacterized protein
STRINGGorai.006G142000.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2443434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-58G2-like family protein