PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_07250_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 506aa    MW: 55211.1 Da    PI: 5.6707
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_07250_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.49.2e-26196252259
                                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 +DgynWrKYGqK+vk+ + +rsYY+Ct+++C+vkk +e+s++ ++v+ei+++g H+he
  Cotton_A_07250_BGI-A2_v1.0 196 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSNCQVKK-IECSDQTGHVIEIVNKGIHTHE 252
                                 8********************************98.*********************8 PP

2WRKY96.61.7e-30369425359
                                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 Dgy+WrKYGqK+vkg+ +pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Cotton_A_07250_BGI-A2_v1.0 369 DGYRWRKYGQKMVKGNSNPRNYYRCTSAGCPVRKHIETAVDNTNAVVITYKGVHDHD 425
                                 9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-21192254IPR003657WRKY domain
SuperFamilySSF1182908.76E-20193254IPR003657WRKY domain
SMARTSM007741.6E-24195253IPR003657WRKY domain
PROSITE profilePS5081116.375196254IPR003657WRKY domain
PfamPF031065.3E-17197252IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-30352427IPR003657WRKY domain
PROSITE profilePS5081130.802362427IPR003657WRKY domain
SuperFamilySSF1182902.22E-26363427IPR003657WRKY domain
SMARTSM007743.9E-34367426IPR003657WRKY domain
PfamPF031061.4E-22369424IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MAETGSQAKR HEGKQYDNSE GEEEEEEEEE EEEEVDELED EEEEEEEGVS RVNESHGAGT  60
APSSDAEVRD SQLETLTNDD RCERLQENPT SELKEGAESK EQVKIAHQKA LPSLAVQGAE  120
APKQHLLQSS VSPTSSSQPS PTSITQDISS PPTPTLPAQS HSDQKVNGAS PPVASQQNPS  180
NLKMLSFVPV VKTPVSDGYN WRKYGQKQVK SPKGSRSYYK CTFSNCQVKK IECSDQTGHV  240
IEIVNKGIHT HEPPRKMNFT RENKILSPAV PLSIVREQPS RIPNDSDPST SSKESLPEPT  300
VNPERKRQCS SGSDGHGDVQ MKKELLSEAE PNKRQRKKGD AVCPGSVVKT GKKPKFVVHA  360
AGDVGISGDG YRWRKYGQKM VKGNSNPRNY YRCTSAGCPV RKHIETAVDN TNAVVITYKG  420
VHDHDMPVPK KRHGPSSAPL VAAAAPASMN NLQLAIADGE QKQVTSTKWS VDTEGELTGE  480
AVDLGGEKAM ESARTLLSIG FEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-24355427274WRKY transcription factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697600.0KF669760.1 Gossypium hirsutum WRKY transcription factor 10 (WRKY10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443066.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-133WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A068LI640.0A0A068LI64_G
STRINGGLYMA02G36510.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-125WRKY DNA-binding protein 32