PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_06358_BGI-A2_v1.0
Common NameF383_15823
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 392aa    MW: 44415.7 Da    PI: 9.0653
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_06358_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32244299156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cotton_A_06358_BGI-A2_v1.0 244 KQRRCWSSELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 299
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.602241301IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-29242302IPR009057Homeodomain-like
SuperFamilySSF466891.16E-17242302IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-27244299IPR006447Myb domain, plants
PfamPF002493.9E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGSVPSELSL DFRPKFIPKT ISNFLEEISL MGSVSDKVSK LDSFVKRLEE EMRKIDGFKR  60
ELPLSMLLLN DAILALKEES TQCVRRRNVE PVLEEFIPLK NNRKENNNHS DDEEEDDSKK  120
NWMSSVQLWN TEDDDHSSID DKLDTKRNHG DPFKNRGKVR GFMPFKANLS FAVKKEEKRE  180
IPIHGLTILT PGIKNPKVEL GFTESRMSRS RAASCSSLKG QVNYRSELQP LSDHQQQQQQ  240
ATRKQRRCWS SELHRRFVNA LQQLGGSQVA TPKQIRELMQ VDGLTNDEVK SHLQKYRLHT  300
RRLPPSTRTT TTPANESALV LGNGLWLSHD QYGDSSKGSS SQSGSPQGPL QLATNTGGTS  360
TTRGDSTEDE EDAKSEAYSW KTRTHKPGKD HV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017612983.10.0PREDICTED: myb family transcription factor EFM-like
RefseqXP_017612984.10.0PREDICTED: myb family transcription factor EFM-like
RefseqXP_017612985.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A1U8N9L80.0A0A1U8N9L8_GOSHI; uncharacterized protein LOC107945126
TrEMBLA0A2P5X6J70.0A0A2P5X6J7_GOSBA; Uncharacterized protein
STRINGGorai.012G150500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-45G2-like family protein