PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05847_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 352aa    MW: 39037.3 Da    PI: 9.2837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05847_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.2e-333488155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Cotton_A_05847_BGI-A2_v1.0 34 KPRLRWTVELHDRFVDAVTQLGGADKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-323189IPR009057Homeodomain-like
PROSITE profilePS5129411.1033191IPR017930Myb domain
SuperFamilySSF466892.15E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-233489IPR006447Myb domain, plants
PfamPF002493.6E-73686IPR001005SANT/Myb domain
PfamPF143793.1E-22127166IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MFQPKKPSTM NSHHDNRPMC VQPDSGLVLT TDPKPRLRWT VELHDRFVDA VTQLGGADKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEFNDHS IKDGKRSDLQ RTSASSSGMM  120
ARSMNEMQME VQRRLHEQLE VQRHLQLRIE AQGKYMQSIL EKACQTLAGE NMAAAGGAAG  180
GYKGVGNHRG VLPHMDGAMK DNFGPTLNYP PFQDLNIYGG DQHLDIQHNV ERSSPSLDGH  240
FMSNKRHGPY GGGGGTGKSP LLWSDELRLQ DLGMAPSCLG PQDDPFKTGV IQIGPPSIDT  300
SGIGKLESLS DIYDTKPGIS NDSIDERKFE LSPKPERPSP RRAPFQTERM NP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-193490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-193490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-193490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-193490157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5795741e-64JX579574.1 Gossypium hirsutum clone NBRI_GE11842 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016714947.10.0PREDICTED: myb family transcription factor APL-like isoform X3
SwissprotQ9SAK51e-116APL_ARATH; Myb family transcription factor APL
TrEMBLA0A1U8LK410.0A0A1U8LK41_GOSHI; myb family transcription factor APL-like isoform X3
STRINGGorai.004G268700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-103G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]