PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05760_BGI-A2_v1.0
Common NameF383_17006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 326aa    MW: 37400.1 Da    PI: 8.9588
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05760_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.75.7e-15221031399
                                 TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                          B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                                 ++ l lpk+f++ +g +   s t++++ ++g +W+v+l   k++g+++l++GWk+F++   Lk g  ++F+++g+s+f +v++
  Cotton_A_05760_BGI-A2_v1.0  22 TQKLPLPKRFVSLYGDD--LSNTVIVKAPTGPEWKVEL--MKCDGEIWLANGWKDFADYFSLKYGNLLIFRYEGHSRF-YVFM 99 
                                 46689******999988..889****************..*********************************99999.9999 PP

                                 EE-S CS
                          B3  96 vfrk 99 
                                 +f++
  Cotton_A_05760_BGI-A2_v1.0 100 IFDQ 103
                                 9986 PP

2B3567.4e-18211307199
                                 EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                          B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                                 ff v +++++ +  r  +p +fa+++     ++ +++l+d++gr+W + l++ +k   + +++GWk F+ +n+L++gD++ F+
  Cotton_A_05760_BGI-A2_v1.0 211 FFVVNIQPSYITAFRANVPFTFARTYFTW--KEADVVLKDRDGRTWPIHLKVYNKYHCTSFGRGWKAFAIDNDLRVGDSCAFE 291
                                 88899999999***************744..4558***************87555556789********************** PP

                                 E-SSSEE..EEEEE-S CS
                          B3  84 ldgrsefelvvkvfrk 99 
                                 l +  e +++v+vfr+
  Cotton_A_05760_BGI-A2_v1.0 292 LLEGPEISFRVTVFRN 307
                                 998888889**99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-188100IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-19999IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.08410103IPR003340B3 DNA binding domain
CDDcd100174.93E-1413102No hitNo description
SMARTSM010191.5E-1114104IPR003340B3 DNA binding domain
PfamPF023624.3E-1221103IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-23205306IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-23205307IPR015300DNA-binding pseudobarrel domain
CDDcd100179.39E-21210306No hitNo description
PROSITE profilePS5086314.156211308IPR003340B3 DNA binding domain
SMARTSM010191.6E-15211308IPR003340B3 DNA binding domain
PfamPF023622.2E-15211307IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MLTSSMNHPK TLHFFRIILS QTQKLPLPKR FVSLYGDDLS NTVIVKAPTG PEWKVELMKC  60
DGEIWLANGW KDFADYFSLK YGNLLIFRYE GHSRFYVFMI FDQTTLEIEY PNGIDNHEVE  120
LQIPDVEEVG SEDVVEIVNN VSRSRKTTEK TRSSPRKRTR MQGATNAKKS EFRMSSRDGS  180
KIGPEQAGGG TSAAQRLSAS SANHFGSEKP FFVVNIQPSY ITAFRANVPF TFARTYFTWK  240
EADVVLKDRD GRTWPIHLKV YNKYHCTSFG RGWKAFAIDN DLRVGDSCAF ELLEGPEISF  300
RVTVFRNPED SNDRHTSSTY NTYKHH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476850.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A0B0MJI20.0A0A0B0MJI2_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2438934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-31B3 family protein