PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05312_BGI-A2_v1.0
Common NameF383_02430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 322aa    MW: 34595.3 Da    PI: 8.0085
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05312_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.32.4e-6521471150
                      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaag 83 
                                 ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc eAGw+ve+DGtty+kg+kp +++++ g
  Cotton_A_05312_BGI-A2_v1.0   2 TSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAGWTVEEDGTTYKKGCKPVDRMDILG 84 
                                 5899******************************************************************************* PP

                      DUF822  84 ssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                                  sasasp+ss++        +sp++sy++sp sssfpsp+s+    + +     +sl+p+l++ls+ sss+
  Cotton_A_05312_BGI-A2_v1.0  85 GSASASPCSSYH--------PSPCASYNPSPGSSSFPSPASSHYRANGNGnadaNSLIPWLKNLSSGSSSA 147
                                 ************........******************9987665444335677**********9977664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-663141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCDEAG  60
WTVEEDGTTY KKGCKPVDRM DILGGSASAS PCSSYHPSPC ASYNPSPGSS SFPSPASSHY  120
RANGNGNADA NSLIPWLKNL SSGSSSASSK LAHHLYFAGG SISAPVTPPL SSPTSRTPRA  180
RNDWDETTGG SARTGQRHCY LPSSTPPSPN HQVFPDPEWL SSGPTSPTFS LVSRNPFGFK  240
DEALSAGGSR MWTPGQSGTC SPAFPAGVDQ TSDVPMSDVI AAEFAFGSNF TGLVKPWEGE  300
KIHEECVADD DLELTLGNSK TR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449695.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-132BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0B0P1230.0A0A0B0P123_G
STRINGPOPTR_0004s06100.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-105BES1/BZR1 homolog 4