PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05133_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 260aa    MW: 29837.6 Da    PI: 9.5135
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05133_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.89.2e-161150342
                                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                i n+s  + t+ kR++g++KK +ELS+LC+++v+ i++ +
  Cotton_A_05133_BGI-A2_v1.0 11 ITNDSAMKATYKKRKKGLMKKVSELSTLCGINVCAIMYNP 50
                                8999*********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.773149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-20178IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-19160IPR002100Transcription factor, MADS-box
CDDcd002667.91E-16282No hitNo description
PRINTSPR004047.0E-6323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-161151IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MTRKNVKLAY ITNDSAMKAT YKKRKKGLMK KVSELSTLCG INVCAIMYNP YESQPKVWPS  60
PMGVQRVLSK FKAILRWNKL LDENMREIDK RIAALANTPL NPKGALPSLS SSVAALPPMT  120
MVTLEAISRI IIKDMLQTKV NNMDQIQRQQ WIIEMMNNNN KNPQTHMAFG GNEMMFQFGD  180
NINLNNGLCK AKAQGTNINE ILDSKWIIPW MHVRLIGQDY ERRHSMRVPH LLSNKYTLMQ  240
FGTQSEEGNE EEEDDDDKED
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6184102e-71JX618410.1 Gossypium hirsutum clone NBRI_GE63878 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016700239.11e-46PREDICTED: MADS-box transcription factor PHERES 2-like
TrEMBLA0A2P5SN143e-68A0A2P5SN14_GOSBA; Uncharacterized protein
STRINGGorai.013G155200.15e-65(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-25AGAMOUS-like 80