PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_04901_BGI-A2_v1.0
Common NameF383_02076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 283aa    MW: 31073.1 Da    PI: 6.4059
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_04901_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-332276155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                kprlrWt +LH+rFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Cotton_A_04901_BGI-A2_v1.0 22 KPRLRWTADLHDRFVDAVTQLGGPNKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 76
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2451979IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-311977IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-242277IPR006447Myb domain, plants
SuperFamilySSF466899.5E-172278IPR009057Homeodomain-like
PfamPF002492.7E-72475IPR001005SANT/Myb domain
PfamPF143791.5E-15120165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MLNNLNRKGI GEPYLVLTSD PKPRLRWTAD LHDRFVDAVT QLGGPNKATP KAIMRTMNVK  60
GLTLFHLKSH LQKYRLGKQS GKDMGEGPKD GISASYLLES PGTNNSTINL STADVNEGYE  120
VREALRAQME VQSKLHLQLE AEKHLQIRQD AERKYMAMLE RACKMLADHF IGSGAVTETD  180
NLEFGSKMLR NYSVDPLGFY SSQSAEVENA CGQEEEMPSG LHSQRGDGST ESCLTSQESP  240
GGLTMEGSPV EGKKKMVNME ATTGSVIWGD TRVNPQGLTG YGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-182278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-182278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-182278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-182278157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-182278258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017638844.10.0PREDICTED: protein PHR1-LIKE 2-like
SwissprotQ94A573e-61PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A0B0N5V90.0A0A0B0N5V9_GOSAR; Myb family transcription factor APL
TrEMBLA0A1U8PL240.0A0A1U8PL24_GOSHI; uncharacterized protein LOC107960134
STRINGGorai.010G247200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17085911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-63G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]