PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_04900_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 342aa    MW: 36972.5 Da    PI: 8.6387
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_04900_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3347101155
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 k+rlrWt+eLH+rFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Cotton_A_04900_BGI-A2_v1.0  47 KQRLRWTHELHDRFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 101
                                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.01444104IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-3246102IPR009057Homeodomain-like
SuperFamilySSF466891.16E-1746101IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-2647102IPR006447Myb domain, plants
PfamPF002492.7E-949100IPR001005SANT/Myb domain
PfamPF143793.3E-17133187IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MYHPKTVPGS SLVRSNSLVH GQHLDCGASS MDPVSGGNSS NPNLASKQRL RWTHELHDRF  60
VDAVAQLGGP DRATPKGVLR VMGVQGLTIY HVKSHLQKYR LAKYLPDSSS DGKKPDKKET  120
GDMLSNLDGS SGMQITEALK LQMEVQKRLH EQLEAYFTSD IQQVQRQLQL RIEAQGKYLK  180
KIIEEQRLGG VLAEAPGTGA SVPALGDNGL ESEKKTDPAT PAPTSESPLQ DKAAKEGTSA  240
KSHSVDESFS SHHEPLTPDS GCHVGSPAGS PKGEMLKKKQ RVSMAGAFAK PEMVLPHQIL  300
DSSINASYQQ SQSVFMREQF NPSSGISIRN ENQSGKGSGT EL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017642563.10.0PREDICTED: myb family transcription factor PHL7
SwissprotQ9SJW01e-126PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A2P5WFR70.0A0A2P5WFR7_GOSBA; Uncharacterized protein
STRINGEOY290600.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87532536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-111G2-like family protein