PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_03448_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 349aa    MW: 39450.7 Da    PI: 7.7455
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_03448_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-3268121255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtp+LH rFv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  Cotton_A_03448_BGI-A2_v1.0  68 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMYRS 121
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.72964124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-3064122IPR009057Homeodomain-like
SuperFamilySSF466894.12E-1566122IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-2368123IPR006447Myb domain, plants
PfamPF002495.7E-1069120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MERNSSTECS KTAPSEQSDH QVEAEADSES EENDGESMPR NGGSSSNSTV EENDKKPSVR  60
PYVRSKMPRL RWTPDLHLRF VHAVERLGGQ DRATPKLVLQ MMNIKGLSIA HVKSHLQMYR  120
SKKIDDPRQV ISDHRHLVQS RDGNIFSLNQ LPMLQGYNHH HQGDSSNAFR DTSWNGRHFS  180
MRNPYTSRSF TDKQIPVLHG TVTDKIFGSN WTNYNFRMDT SSFNTLLPSW KCHEVLKNEI  240
SSSSPNLQSL LTKPSTQAKV EDETNCSRNS AQEHRAMKRA ISDSNLDLDL TLRLTQAKEE  300
KRPSSEEDDV GLSLSLCGPP SSSKLSRLKG EDDSSRENGR RVSTLDLTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-1769123357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-1769123458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016739121.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A1U8NJD60.0A0A1U8NJD6_GOSHI; putative Myb family transcription factor At1g14600 isoform X2
STRINGGorai.012G117800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-66G2-like family protein