PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_02500_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 271aa    MW: 30695.6 Da    PI: 8.7429
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_02500_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.5e-311266155
                     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                k+rlrWt+eLH+rF +av+qLGG+++AtPk il++m+v+gLt++hvkSHLQk+R+
  Cotton_A_02500_BGI-A2_v1.0 12 KERLRWTQELHDRFEQAVNQLGGPDRATPKGILKAMGVDGLTIYHVKSHLQKFRI 66
                                68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.335969IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-291166IPR009057Homeodomain-like
SuperFamilySSF466896.99E-181166IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-251266IPR006447Myb domain, plants
PfamPF002492.2E-91464IPR001005SANT/Myb domain
PfamPF143798.2E-8101141IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MRRPSRADGL AKERLRWTQE LHDRFEQAVN QLGGPDRATP KGILKAMGVD GLTIYHVKSH  60
LQKFRILKFV PETNTSKLKQ PYLRGEIFQK YCLILVQHRA QLNEALQLYM EAQRKQGDDK  120
LQVRRNLKIK FEAQARYFER IAGEHRNRVT PTKATKSLSP ISLPSLCEES ESNSKDFETD  180
PEADKNEIES GERIQALKRA GIVEDNSASS SSSSSSSSMY ALPSSFSADG YEYDDQNMLL  240
NGGERLSYTA NDNSFPWNIP VCSSPLVPSF M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-211269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-211269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-211269158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-211269158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-211169159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5276361e-109HQ527636.1 Gossypium herbaceum clone NBRI_B_EYI1BW404IW7BW simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017609200.11e-173PREDICTED: myb family transcription factor PHL7-like
RefseqXP_017609201.11e-173PREDICTED: myb family transcription factor PHL7-like
TrEMBLA0A1U8MF181e-169A0A1U8MF18_GOSHI; protein PHR1-LIKE 1-like
STRINGGorai.006G182800.11e-165(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM168021011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-38G2-like family protein