PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_02285_BGI-A2_v1.0
Common NameF383_23510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 634aa    MW: 69188.1 Da    PI: 7.5909
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_02285_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093654021954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Cotton_A_02285_BGI-A2_v1.0 365 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 402
                                 554459******************************88 PP

2BELL127.35.7e-41228299172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vissFe++ag+gsak YtslAlk+iS++FrcLkdai++qi
  Cotton_A_02285_BGI-A2_v1.0 228 ERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVISSFEQAAGIGSAKTYTSLALKTISKQFRCLKDAITGQI 299
                                 79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-66154297IPR006563POX domain
PfamPF075267.8E-50159296IPR006563POX domain
PROSITE profilePS5007112.147343406IPR001356Homeobox domain
SMARTSM003891.8E-9346410IPR001356Homeobox domain
CDDcd000862.83E-12346407No hitNo description
SuperFamilySSF466896.84E-17347412IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28349412IPR009057Homeodomain-like
PfamPF059204.2E-18363402IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MATYFHGNPE IQAPDGLQTL VLMNPAYVQY SDTTPPPQPN NLVFHAPPPP HTQQFVGVPL  60
TATSTANQDP PSHEISPLHG LVQRVHYNLY NPIDPSGAAR ETPRAQQGLS LSLSSQQQQH  120
HHGYGSHAQA VSGEDMRVSG GSGSSGSGVT NGVSGVQSML LSSKFLKAAQ ELLDEVVNVN  180
NTGITKNELA KKGRGGGDNS NSSKAVGESA AAAGDADGKQ GPELTTAERQ EIQMKKAKLI  240
SMLDEVDQRY RQYHHQMQIV ISSFEQAAGI GSAKTYTSLA LKTISKQFRC LKDAITGQIR  300
AANKSLGEED CLGGSKIEGS RLKLVDHHLR QQRALQQLGM IQHNAWRPQR GLPERSVSVL  360
RAWLFEHFLH PYPKDSDKVM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYLEEIKEQE  420
QNGSEKKTSK SHNNEDSTSK STAPDKTSTE NKQDNNIPNQ NGCSSMSVSM GSASPLIGNQ  480
SGFSFIGSSE LEGITQGSPK KPRTNNEVTM KFDKDGYTFM GGTTNNDFMG GFGQYPIGEI  540
TRFDTEQFTP RFSGNGVSLT LGLPHCENLS LSGTPHQTFL PNQAMQMGRR VDIGEPNEFG  600
SINPSTPHSS AAYDNINIQN RKRFAAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16352410563Homeobox protein Meis2
3k2a_B8e-16352410563Homeobox protein Meis2
4xrs_A8e-16352409158Homeobox protein Meis1
4xrs_B8e-16352409158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017620234.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0B0MQX80.0A0A0B0MQX8_GOSAR; BEL1-like homeodomain protein 1
STRINGGorai.002G234900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-170BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]