PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_02042_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 328aa    MW: 36819.5 Da    PI: 6.5177
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_02042_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-31206261156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+ Fv+a++qLGGs++AtPk+i+e+m+v++Lt+++vkSHLQkYRl+
  Cotton_A_02042_BGI-A2_v1.0 206 KQRRCWSPELHRLFVDALQQLGGSQVATPKQIKEVMQVDDLTNDEVKSHLQKYRLH 261
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-28203264IPR009057Homeodomain-like
PROSITE profilePS5129413.548203263IPR017930Myb domain
SuperFamilySSF466895.82E-18204264IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-26206261IPR006447Myb domain, plants
PfamPF002492.6E-7208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
ELSLDLSSVF VPKTITEFLK EASKIKDGFQ RSSKISDYVK RLEDEMKKID GFKRELPLCM  60
LLLKDGIERL KVEEMQCKET DDGLPLKEND DGDKTNWLSS VQLWNSDFNI VDHNTEHSFR  120
AETDMSENPI KVCNNKSRGG AFVPFKDISG IRLMNPSFEL VSCNGILRNN GGCTIGSGSS  180
LTAEKTQIKF QTESQDQQKL QQNSRKQRRC WSPELHRLFV DALQQLGGSQ VATPKQIKEV  240
MQVDDLTNDE VKSHLQKYRL HIRKLPPSST RNQCSENMKS QSGSPQCPLT VSALAKGMSS  300
TGGDSMDGEE DEKSDGLSWR SGVHKPGE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8377002e-50JQ837700.1 Gossypium hirsutum cultivar ZM3 MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017636340.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A2P5RPV80.0A0A2P5RPV8_GOSBA; Uncharacterized protein
STRINGGorai.007G053100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-62G2-like family protein