PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01678_BGI-A2_v1.0
Common NameF383_26303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 353aa    MW: 40313.3 Da    PI: 6.5299
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01678_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32225280156
                     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                 k+r++W+peLH+rFvea+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cotton_A_01678_BGI-A2_v1.0 225 KQRRCWSPELHKRFVEALQKLGGSKVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 280
                                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.212222282IPR017930Myb domain
SuperFamilySSF466892.94E-18223283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28224283IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-27225280IPR006447Myb domain, plants
PfamPF002495.3E-9227278IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MELNMDVDLV YVPETVSEFL KQASKIKNGF QRLCKISDYV RRLEDEMKKI DAFKRELPLC  60
MLLLKDVIKR LKEEEMMCKE LGDGSVTIDE GNGKVNKEND GGAGDKRNWR STVQLWNSDS  120
DNVDQNKKPN KVPRLKLRSE EEEEEEQDMF EDPIEFFNNK RFKGQMDKDN LELSLMTPSF  180
DLGSSSPSHN PILKINDNCK TGFGSDQNQT KFQTKHQQDM QNCKKQRRCW SPELHKRFVE  240
ALQKLGGSKV ATPKQIRELM QVDGLTNDEV KSHLQKYRLH FRKVASDSSA QNQCNEKMKA  300
NISESDSPQG PLRAGGWTKG LSSGGSVVEG EDDEKSDGRS WRSGVTKTGE IEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-15225278154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-15225278154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-15225278154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-15225278154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8377000.0JQ837700.1 Gossypium hirsutum cultivar ZM3 MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017640363.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A0B0MVC50.0A0A0B0MVC5_GOSAR; Two-component response regulator ARR1-like protein
STRINGGorai.003G021300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-56G2-like family protein