PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01461_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 321aa    MW: 35207.5 Da    PI: 7.5497
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01461_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32196249255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cotton_A_01461_BGI-A2_v1.0 196 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 249
                                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-15193250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-29194250IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-24196249IPR006447Myb domain, plants
PfamPF002494.1E-7197248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEEKGGFNEQ CMNRIPDLSL HISPPNTAPP SISTATTSES HSSTFDIWSI KQYDALKPCS  60
SSQAAETELS LANPLGPVGS GVEPESCPRQ IHLLKCGQLS DINYGVSWLD DMPEPGLKPI  120
KGIPIYTDPR KSRPLYQVSP YSSYNCSSSS SASAPWVLHS ANGYRFNGIS MPQYEGSMGS  180
SRFIAKVHSK KNIRAPRMRW TSSLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV  240
KSHLQMYRTV KSTDKAAAAF SDGSGEEDED CLGVAKNRNS SVKQRSTETE YNVNGCPSSS  300
NLWTISSTYV SQLNLWFGIQ T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-17197251458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017636858.10.0PREDICTED: probable transcription factor KAN2
TrEMBLA0A1U8LUN80.0A0A1U8LUN8_GOSHI; probable transcription factor KAN2
STRINGGorai.008G292400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17814510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-46G2-like family protein