PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_01196_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 425aa    MW: 46917.3 Da    PI: 6.2666
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_01196_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.9e-073744072154
                                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cotton_A_01196_BGI-A2_v1.0 374 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 407
                                 469*****************************87 PP

2ELK28.82.8e-10328349122
                         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                 ELKh+L+++Y+++++++++E++
  Cotton_A_01196_BGI-A2_v1.0 328 ELKHELKQGYKEKIVDIREEIL 349
                                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-18160204IPR005540KNOX1
PfamPF037903.0E-16162203IPR005540KNOX1
SMARTSM012562.5E-29216271IPR005541KNOX2
PfamPF037912.7E-21220270IPR005541KNOX2
PfamPF037899.9E-7328349IPR005539ELK domain
PROSITE profilePS512139.969328348IPR005539ELK domain
SMARTSM011886.1E-4328349IPR005539ELK domain
PROSITE profilePS5007111.451348411IPR001356Homeobox domain
SMARTSM003893.1E-10350415IPR001356Homeobox domain
SuperFamilySSF466891.45E-15351414IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-25355412IPR009057Homeodomain-like
CDDcd000863.68E-11362412No hitNo description
PfamPF059209.8E-18368407IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAFHPNHLSQ DLPLHHFTFQ QQQTNQLPET TAPNWLNTAL LRSQQESQPP QPHAHFSDPN  60
FLNLHTATTA SESTSASQAP NQWLSPSSSS LLQRNHSGVV DDVAAVAAAG GGVGRETMVA  120
VEPGELKSSN SESMNNNNKS EGVAVESGGG GDGAVNWQNA RYKAEVLAHP LYEQLLSAHV  180
ACLRIATPVD QLPRIDSQLA QSQHVVAKYS ALGGGAQGLV GDDKELDQFM THYVLLLCSF  240
KEQLQQHVRV HAMEAVMACW EIEQSLQSLT GVSPGEGTGA TMSDDDEEQI DSDANLFDGS  300
MEGPDSLGFG PLVPTESERS LMERVRQELK HELKQGYKEK IVDIREEILR KRRAGKLPGG  360
TTSVLKAWWQ SHSKWPYPTE EDKAKLVQET GLQLKQINNW FINQRKRNWH SNPSTSTVLK  420
NKRKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1404424RKRNWHSNPSTSTVLKNKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017627618.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A1U8PGW60.0A0A1U8PGW6_GOSHI; homeobox protein knotted-1-like 3
TrEMBLA0A2P5WPI50.0A0A2P5WPI5_GOSBA; Uncharacterized protein
STRINGGorai.009G060200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]