PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00950_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 372aa    MW: 40711.8 Da    PI: 5.5205
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00950_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.15e-42149245298
                      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskeh 84 
                                 lfqrl+se+Dei+lL+G++d+ ak+g++p +d+++fyefvkksi+ +vsk ql++KirrLKkKfk++  k ++g++p+fsk+h
  Cotton_A_00950_BGI-A2_v1.0 149 LFQRLFSEDDEIALLKGMLDYSAKKGADPCADMNKFYEFVKKSIHTDVSKVQLMDKIRRLKKKFKNNAGKNNKGEDPTFSKPH 231
                                 69********************************************************************************* PP

                      DUF573  85 dqkifelskkiWgs 98 
                                 +q++felsk+iWg+
  Cotton_A_00950_BGI-A2_v1.0 232 EQNAFELSKQIWGK 245
                                 ************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.8E-36150244IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MAPKRSNPIE VPPAASSSEE DEEVTSSGEV DEGSSTEEED EDDPKTQSTP LRQKSPSPRK  60
LETATPAIVK EESDESGSDS ESDTAAQIAI ATKPRCNKPL ASSSKRPGES ELDAKEAKRP  120
KKKVGEEGMA TAPVVEGVKK TGEDAKKLLF QRLFSEDDEI ALLKGMLDYS AKKGADPCAD  180
MNKFYEFVKK SIHTDVSKVQ LMDKIRRLKK KFKNNAGKNN KGEDPTFSKP HEQNAFELSK  240
QIWGKEGISG KVASSTAKSN GKAKGNKKAE IAVKAELLSS SDQKIDDAVP VEVDEVVSKS  300
SSSFLDKKFS LSDLEEAVVK VGLDMVDGEK KAALEAKWMK LQVAQLEAYA RRTEFVAEQA  360
KLLLKYYKSE EK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512650.0JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465288.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A0D2W2020.0A0A0D2W202_G
STRINGPOPTR_0001s30110.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-28DNA-binding storekeeper protein-related transcriptional regulator