PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00772_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 170aa    MW: 19629.5 Da    PI: 9.5816
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00772_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.52.1e-12881521784
                                 E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                          B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                                 ++p +fa++  ++ e++k+ t+  ++   W+v +    +    v++ GW +Fv++n++k+g ++vF+l
  Cotton_A_00772_BGI-A2_v1.0  88 SVPSSFAKAQYLP-ETKKEFTFSATKQGYWKVGF--VCSEMDKVFSHGWCKFVRDNEMKVGNTCVFEL 152
                                 89*****877666.5668****************..55555589***********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-122946IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-1187153IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-1288152IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-988153IPR003340B3 DNA binding domain
CDDcd100174.47E-788152No hitNo description
PROSITE profilePS508639.64389170IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MDLRLCLHRQ KKMRSSTKDL NSNIPNHDNR PSFFKLITHD TNANHSWIFD KTGVERETGP  60
MTGKHRGFSV EIKEEDDANR KNTPCPPSVP SSFAKAQYLP ETKKEFTFSA TKQGYWKVGF  120
VCSEMDKVFS HGWCKFVRDN EMKVGNTCVF ELWLLKKSKP IFSTSMICNV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6105485e-62JX610548.1 Gossypium hirsutum clone NBRI_GE52301 microsatellite sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3542422