PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00771_BGI-A2_v1.0
Common NameF383_00685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family B3
Protein Properties Length: 343aa    MW: 39692.3 Da    PI: 8.9301
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00771_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.51.6e-15595197
                                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
                                ff +l+ s +l+ + l++p +f++++  +   s+   l+ ++g +W+v +  +k +++ ++++GW+eFv+   + +g f++F+++
  Cotton_A_00771_BGI-A2_v1.0  5 FFHKLILSTTLQDRKLRIPDNFIKKFRDE--LSVAAALTVPDGHVWRVGI--KKVDNKAWFKEGWQEFVERYYISVGYFLIFRYE 85
                                788999999**************999755..999****************..99999**************************** PP

                                SSSEE..EEEEE CS
                          B3 86 grsefelvvkvf 97
                                g+s f   v++f
  Cotton_A_00771_BGI-A2_v1.0 86 GNSAF--SVSIF 95
                                *9999..88887 PP

2B362.66.3e-20241331498
                                 E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                          B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                                 vl ps+  + ++++lp  fae+h +g++     ++l+ ++gr+W v++ yr+++    +++GW eF  +n+L egD++vF+l 
  Cotton_A_00771_BGI-A2_v1.0 241 VLRPSYLYRGCIMYLPSCFAEQHlSGVSG---FIKLQLPDGRQWPVRCLYRGGR--AKFSQGWYEFTLENNLGEGDVCVFELL 318
                                 78899******************866743...5***************666665..5699**********************9 PP

                                 SSSEE..EEEEE- CS
                          B3  86 grsefelvvkvfr 98 
                                 +++ef l+v+vfr
  Cotton_A_00771_BGI-A2_v1.0 319 RSREFVLKVTVFR 331
                                 99*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.5E-21396IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-20396IPR015300DNA-binding pseudobarrel domain
CDDcd100171.40E-16596No hitNo description
PfamPF023621.4E-12595IPR003340B3 DNA binding domain
PROSITE profilePS5086313.267598IPR003340B3 DNA binding domain
SMARTSM010193.5E-13698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.2E-25230331IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-25231331IPR015300DNA-binding pseudobarrel domain
CDDcd100172.40E-23236331No hitNo description
SMARTSM010191.0E-22238333IPR003340B3 DNA binding domain
PROSITE profilePS5086313.648238333IPR003340B3 DNA binding domain
PfamPF023628.0E-18241331IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MPRPFFHKLI LSTTLQDRKL RIPDNFIKKF RDELSVAAAL TVPDGHVWRV GIKKVDNKAW  60
FKEGWQEFVE RYYISVGYFL IFRYEGNSAF SVSIFNLYNS EINYQTNALV GNQYNLGRQY  120
PFEELEDDEC VSPALPNLFG GSKLNCINWS GEVNHHAPKG VNNQPIRGAE LPKLKKPGRK  180
KQKFEPSEED SSLGHEDDME MRNRFYESAS ARKRIVTAEE RERAINAAKA FEPTNPFCRV  240
VLRPSYLYRG CIMYLPSCFA EQHLSGVSGF IKLQLPDGRQ WPVRCLYRGG RAKFSQGWYE  300
FTLENNLGEG DVCVFELLRS REFVLKVTVF RVMESAGLMY RSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-7620433415144B3 domain-containing transcription factor VRN
4i1k_B3e-7620433415144B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480290.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2
SwissprotQ8L3W11e-154VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A0B0MM460.0A0A0B0MM46_G
STRINGPOPTR_0009s11170.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112428103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-150B3 family protein