PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00715_BGI-A2_v1.0
Common NameF383_06836
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 661aa    MW: 72892 Da    PI: 6.6936
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00715_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-094014381954
                                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                 Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  Cotton_A_00715_BGI-A2_v1.0 401 FEHflHPYPKDSEKIMLARQTGLTRSQVSNWFINARVR 438
                                 664459******************************88 PP

2BELL127.74e-41263334172
                        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                 erqelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+a+ag+g+akpYt++Al++iSrhFrcLkd i +qi
  Cotton_A_00715_BGI-A2_v1.0 263 ERQELQSKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDAIAGCGAAKPYTAVALQTISRHFRCLKDTINGQI 334
                                 79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-62192332IPR006563POX domain
PfamPF075269.5E-51198330IPR006563POX domain
PROSITE profilePS5007112.325379442IPR001356Homeobox domain
SMARTSM003894.3E-10382446IPR001356Homeobox domain
CDDcd000864.73E-13382443No hitNo description
SuperFamilySSF466891.2E-17383449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29385448IPR009057Homeodomain-like
PfamPF059207.6E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MATYYTGSDN QKDTIPMIYM RESLPGSYAE SPVLQGNTMM YMNSGSYSDA FAGNSQQQNS  60
CIGMQGVEAS DSTSQQHGIM SNLGGSHVVE HDFGAWRDAS SILHNGQNLQ GPQGLSLRLG  120
TQIPFGIQMA SIPFRNPDSD LASFLSHNPS LTGGRNSSSR DEQPRNAGYL PHGFSGANQG  180
TNKGDLYACG MSSMSRAIPN SKYLKAAQQL LDEVVNVPKA LKQAEGEKNP MKSCKEDDEG  240
SKNVPSNQQE SSNNIQKELS HAERQELQSK LTKLLSMLDE VDRRYKQYYH QMQIVVSSFD  300
AIAGCGAAKP YTAVALQTIS RHFRCLKDTI NGQIQATRKS LGEQDTLEDG KGVRITRLRY  360
VEQQLRQQKA LQQLGMMPQH AWRPQRGLPE SSVSILRAWL FEHFLHPYPK DSEKIMLARQ  420
TGLTRSQVSN WFINARVRLW KPMVEEMYKE EFADLEMDSH SSSENAVKAR KGDTRTSEDI  480
GGDQQQSGSS SATERCSTGQ LVDSKSNHVP DVDIAGTITG TVLQNVSHRE AETEHGLLRL  540
SKVQRPNVDN ANLFLDGITH SDGVGDRFMK ATTTSYHVSE LGRFGNASGV SLTLGLQHCE  600
DGSIPMSGVG HQNFVAMTRD NDIYNPAASS IGPETTDSEY VTPGNRQHRF NSSHLLHDFV  660
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A9e-17388445158Homeobox protein Meis1
4xrs_B9e-17388445158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017633879.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_017633880.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0B0NMB80.0A0A0B0NMB8_GOSAR; BEL1-like homeodomain protein 6
STRINGGorai.005G246400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-146BEL1-like homeodomain 6