PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00303_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 340aa    MW: 38503.9 Da    PI: 9.2278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00303_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-3257110255
                     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 prlrWtp+LH rFv+ave+LGG+++AtPk +lelm++kgL+++hvkSHLQ+YR+
  Cotton_A_00303_BGI-A2_v1.0  57 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLELMNIKGLSIAHVKSHLQMYRS 110
                                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.00653113IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-3053111IPR009057Homeodomain-like
SuperFamilySSF466894.12E-1556111IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-2357112IPR006447Myb domain, plants
PfamPF002491.4E-958109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEENSGTGCS KTVKAETESE ENEGESRPKN GGSSSNSTVE ENEKKLSVRP YVRSKLPRLR  60
WTPDLHLRFV HAVERLGGQD RATPKLVLEL MNIKGLSIAH VKSHLQMYRS KKIDDSGQVI  120
SNHRHLVESG DRNIYNLSQL PMLQGYSNLL HHHHHQGDSS SSFYRYGDAS LGNREYSMRR  180
PYTSTSFINE SRPGLHRTVT EKIFSSNWAS YDFKCNQVQP RLGPIETSSM SQNTSLSIHN  240
SPLISQDLKS TKRKTFDCDL DLDLSLRITA KEDKQPNSEQ GDVVSELSLS LYSPSSSSSK  300
LSRLKSEEDH CTKKNARRVH RLLSVWSCNL VYSSLSREGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1658112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1658112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1658112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1658112357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1658112458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3949411e-125GQ394941.1 Gossypium hirsutum cultivar Delta Opal clone MONCS1964 SSR marker DPL0302 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017622639.10.0PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_017622640.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A1U8PDK60.0A0A1U8PDK6_GOSHI; putative Myb family transcription factor At1g14600
STRINGGorai.002G265400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-64G2-like family protein