PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_00183_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 567aa    MW: 62299 Da    PI: 4.6485
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_00183_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.44.4e-432203462128
                         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                                 ppG+rF Ptdeel+++yL kkv+++ l+  + i evd+y +eP +L +    ++e+ewyfF++r+kky++g r+ r+t++g+W
  Cotton_A_00183_BGI-A2_v1.0 220 PPGVRFAPTDEELIQYYLLKKVNNELLPY-NLIWEVDLYGTEPAKLTEsYEPNGESEWYFFTSRRKKYPNGGRPDRSTENGFW 301
                                 9***************************9.89**************8514445778*************************** PP

                         NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                 k tg dk++ + + + +g kktL f++gr+p+g+kt+W mhey++
  Cotton_A_00183_BGI-A2_v1.0 302 KPTGMDKNIPEGRLKPIGSKKTLEFHTGRHPSGHKTEWKMHEYKV 346
                                 ***********9999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-46217369IPR003441NAC domain
PROSITE profilePS5100546.081219369IPR003441NAC domain
PfamPF023651.5E-23220345IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MQNKEQNFSA AANGGATAPE GHQVVTMAAN IENQNDISNP SIASNMDATV LEGGEIVTAT  60
ENEAYNNILN YSAATDGGAI AYEGSEFETM MEDIFNQNST LSYFAAADGG ATAYEVGQFF  120
TQEENIYNQN SVLNSTVASN IDVAAFEGDQ FFSQDENFYN ELNVLSSTVA SNIETTAFEG  180
GETVTTAENA NNRNNMLNSS TASNGGRTVA EVKDYIQSFP PGVRFAPTDE ELIQYYLLKK  240
VNNELLPYNL IWEVDLYGTE PAKLTESYEP NGESEWYFFT SRRKKYPNGG RPDRSTENGF  300
WKPTGMDKNI PEGRLKPIGS KKTLEFHTGR HPSGHKTEWK MHEYKVDPSL IKPQNKPEDG  360
MTVYKTQRKG QNENNLESFD QNTNTSSSSQ NFDVGASSEA TIVSYPMTGF AGQPDNGLSP  420
LTTSLMPNYE YYSNTWLQPT VDGALNNEAF VPAANRNDTA IRNRNSDTTW PYHPYYSNGL  480
LLHRGVNNGA STSTVARNYI DNNVRAVQVR PPNATLTQVT VNNAGPNGEA HSMAASRSNT  540
MSRGRGEAQR GSRRGGNRGK IIMLPRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-3721834614140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468594.10.0PREDICTED: uncharacterized protein LOC105786622
TrEMBLA0A2P5WB170.0A0A2P5WB17_GOSBA; Uncharacterized protein
STRINGGorai.002G008500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2427034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-39NAC domain containing protein 57