PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna33406.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LFY
Protein Properties Length: 413aa    MW: 45810.3 Da    PI: 7.2633
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna33406.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY591.12.5e-18013951386
                  FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap....leaaaaaaarklr......eleelfkayGvryltvakiaelGftvs 76 
                              mdp+af+aslfkwd r +a++ p+rl+ eaa+++a     ++aaaaaa +++r      +lee+f+ayGvry+t+a+iaelGftvs
  mrna33406.1-v1.0-hybrid   1 MDPNAFTASLFKWDLRGMAVP-PNRLQLEAAAAAAVapqqVAAAAAAAGYSVRapretgGLEEMFRAYGVRYYTAARIAELGFTVS 85 
                              9*************9988765.5566555544443322223444444555566899999*************************** PP

                  FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaag 162
                              tL+dm+deeldd+m+s+++ fr++llvGeryG+k+a+rae+rrleee+  ++rr+ ls d+ +a+dalsqeglseepvq+e+e++g
  mrna33406.1-v1.0-hybrid  86 TLLDMRDEELDDMMNSVCQFFRVELLVGERYGVKSAIRAEKRRLEEED--SRRRHALSGDT-NAMDALSQEGLSEEPVQQEREMVG 168
                              **********************************************88..88899999996.68********************** PP

                  FLO_LFY 163 sggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg...........sgedgeerqrehPfivte 237
                              sgg+   ++e  +a+e+     +kk ++ ++   ++++ ++  d+de+ee+d+  +g           ++ +g+erqrehPf+vte
  mrna33406.1-v1.0-hybrid 169 SGGGA--AWEGGTAAER-----RKKLRRIRRGGGHRSS-NEGIDDDEDEENDDRINGgggerpgralgMRGSGRERQREHPFVVTE 246
                              *9998..6666655532.....2222221222111111.22233333333332222234667778877666788************ PP

                  FLO_LFY 238 pgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalr 323
                              +gevargkknGLDYLf+LyeqC++fL+qvq+iakerGekcPtkvtnqvfryak+ ga+yinkPkmrhYvhCYalhcLdee s alr
  mrna33406.1-v1.0-hybrid 247 AGEVARGKKNGLDYLFHLYEQCHQFLTQVQNIAKERGEKCPTKVTNQVFRYAKEEGANYINKPKMRHYVHCYALHCLDEERSIALR 332
                              ************************************************************************************** PP

                  FLO_LFY 324 rafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                              r+ k rgen+Gawrqacy+p+v+iaa qgwdida+f+ahprLs+WYvPtkLrqLCh+er++a+
  mrna33406.1-v1.0-hybrid 333 RECKLRGENIGAWRQACYRPVVEIAAGQGWDIDAIFSAHPRLSVWYVPTKLRQLCHAERNNAA 395
                              ************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.5E-1821395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDPNAFTASL FKWDLRGMAV PPNRLQLEAA AAAAVAPQQV AAAAAAAGYS VRAPRETGGL  60
EEMFRAYGVR YYTAARIAEL GFTVSTLLDM RDEELDDMMN SVCQFFRVEL LVGERYGVKS  120
AIRAEKRRLE EEDSRRRHAL SGDTNAMDAL SQEGLSEEPV QQEREMVGSG GGAAWEGGTA  180
AERRKKLRRI RRGGGHRSSN EGIDDDEDEE NDDRINGGGG ERPGRALGMR GSGRERQREH  240
PFVVTEAGEV ARGKKNGLDY LFHLYEQCHQ FLTQVQNIAK ERGEKCPTKV TNQVFRYAKE  300
EGANYINKPK MRHYVHCYAL HCLDEERSIA LRRECKLRGE NIGAWRQACY RPVVEIAAGQ  360
GWDIDAIFSA HPRLSVWYVP TKLRQLCHAE RNNAAASSSA SGGSGTADPL PY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-992334082191PROTEIN LEAFY
2vy2_A1e-992334082191PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125136KRRLEEEDSRRR
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna33406.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7882600.0JN788260.1 Fragaria x ananassa LEAFY like protein 2 (LFY-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300371.10.0PREDICTED: floricaula/leafy homolog
SwissprotO485591e-179UNI_PEA; Protein UNIFOLIATA
TrEMBLH6V2T80.0H6V2T8_FRAAN; LEAFY like protein 3
STRINGXP_004300371.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-98floral meristem identity control protein LEAFY (LFY)