PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32456.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 324aa    MW: 37155.9 Da    PI: 9.9311
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32456.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-1867128157
                              TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              rr+R+t+t+eq+ +L+e+++   ++p+a++++  + +l    +++ ++V++WFqN Ra+e++
  mrna32456.1-v1.0-hybrid  67 RRSRWTPTPEQVMALKEMYRCgLKTPTAKQIQLVTVQLrnygRIEGKNVFYWFQNYRARERQ 128
                              89******************99**************************************97 PP

2Wus_type_Homeobox103.11.9e-3368130365
        Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                              r+RWtPtpeQ++ L+e+y++Gl+tP++++iq +t +L++yG+ie+kNVfyWFQN +aRerqk+
  mrna32456.1-v1.0-hybrid  68 RSRWTPTPEQVMALKEMYRCGLKTPTAKQIQLVTVQLRNYGRIEGKNVFYWFQNYRARERQKR 130
                              79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-848128IPR009057Homeodomain-like
PROSITE profilePS5007111.14364129IPR001356Homeobox domain
SuperFamilySSF466892.35E-1165135IPR009057Homeodomain-like
SMARTSM003892.4E-466133IPR001356Homeobox domain
PfamPF000466.0E-1667128IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MNITRDQLPD YYIKAAANLH QPAVLLTPKL TSTSMVRGTS TSTAQGRSSS SGSFCIDKKS  60
EAAAPLRRSR WTPTPEQVMA LKEMYRCGLK TPTAKQIQLV TVQLRNYGRI EGKNVFYWFQ  120
NYRARERQKR RRQVMSMYKS TDSKQQQTFT NNTTSGLQDK ESAGGLTNQS SLEVEQQISL  180
EVEQQNKWKL PNRTVISDQE SSSVLQERMM SMVDCSSRQL VEQMATRRST SDATLIHRKL  240
LDYRHCYHHD YGRMVLTEPT NYRREEESRE TQTLELFPLK SDNLRGAKDT KVPLSRTTST  300
DNTADLIADD IISFFERFKA AYN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna32456.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463852.10.0PREDICTED: WUSCHEL-related homeobox 3B-like
TrEMBLA0A2P6PTZ07e-94A0A2P6PTZ0_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004298470.13e-76(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3380522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-23WOX family protein