PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32024.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 273aa    MW: 29939.4 Da    PI: 4.6841
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32024.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.82e-17129191163
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              ek+lkre+rkq NRe+ArrsR RK+ e eeL + +++L++e ++Lk+el++ k  ++kl+ e+
  mrna32024.1-v1.0-hybrid 129 EKQLKREKRKQANRESARRSRMRKQTEYEELVKSCDSLSTEQMDLKSELDQVKVAAEKLRLEN 191
                              89*********************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-9128188No hitNo description
SMARTSM003382.0E-12129193IPR004827Basic-leucine zipper domain
PfamPF001703.5E-15129191IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.887131194IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-9133181No hitNo description
CDDcd147024.36E-13134180No hitNo description
PROSITE patternPS000360136151IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MTQTRISSTC PQVSIRTWGN TVFLPVECTV LELGFSLVYL RFLGTVFVGD ELVAEERFEL  60
VELVVEDDLT GGADGNSRAD HHTQGEKGSE SLRSAVPIGS LYENIGTSTA IFSPSAGERL  120
PFDAMALDEK QLKREKRKQA NRESARRSRM RKQTEYEELV KSCDSLSTEQ MDLKSELDQV  180
KVAAEKLRLE NAALKEQLKN AQILQEGGNG SPKTEGNVTL PNDGKDILSN LGTVNSNAQL  240
DCETHETSNS ETITRLNQLL ESSSRTDAVA AR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145152RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463957.11e-134PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463956.11e-134PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463955.11e-134PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463954.11e-134PREDICTED: common plant regulatory factor 1-like
TrEMBLM5WDZ42e-45M5WDZ4_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15470810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46270.22e-21G-box binding factor 3