PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32022.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 263aa    MW: 28695.4 Da    PI: 4.5342
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32022.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_156.36.9e-18120182163
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              ek+lkre+rkq NRe+ArrsR RK+ae eeL + +++L++e ++Lk+el++ k  ++kl+ e+
  mrna32022.1-v1.0-hybrid 120 EKQLKREKRKQANRESARRSRMRKQAEYEELVKSCDSLSTEQMDLKSELDQVKVAAEKLRLEN 182
                              89*********************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.9E-10119179No hitNo description
PfamPF001701.2E-15120182IPR004827Basic-leucine zipper domain
SMARTSM003384.0E-13120184IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001122185IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-9124172No hitNo description
CDDcd147022.61E-14125171No hitNo description
PROSITE patternPS000360127142IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDQDVTKKLK GLDGHAVPIS YTSSISFEEN EDDLTGGADG NTPADHHMQG EKGSESLRSA  60
DTDVEVHPNY EGDTNRNFTS SSDFVQVPIG SLYENIGTST AIFSPSAGER LPFDAMALDE  120
KQLKREKRKQ ANRESARRSR MRKQAEYEEL VKSCDSLSTE QMDLKSELDQ VKVAAEKLRL  180
ENAALKEQLK NAQILQEGGN GSPKTEGDVT LPNDAKDILS NLGTVSSNAQ LDCETHETSS  240
ETITRLNQLL ESSSRTDAVA AR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136143RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463954.10.0PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463955.10.0PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463956.10.0PREDICTED: common plant regulatory factor 1-like
RefseqXP_011463957.10.0PREDICTED: common plant regulatory factor 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15470810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46270.19e-23G-box binding factor 3