PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31955.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family B3
Protein Properties Length: 420aa    MW: 47631.9 Da    PI: 9.4017
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31955.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.41.7e-15697298
                             EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                       B3  2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89
                             f +l+ s++l+ ++l +p +fa+++  +   s+ +tl  + g +W++ l  +   ++y++++GW++F +   ++ g f++F+++g+s+
  mrna31955.1-v1.0-hybrid  6 FEKLILSSTLQAKQLKIPENFAKKFRDE--FSTYVTLSVPGGHVWRIGL-KKAAENKYWFQDGWQDFIERYSIRIGYFLIFRYEGNSS 90
                             45677788889999********999755..8899***************.3444555****************************999 PP

                             E..EEEEE- CS
                       B3 90 felvvkvfr 98
                             f   v +f+
  mrna31955.1-v1.0-hybrid 91 F--IVNIFN 97
                             9..999885 PP

2B361.31.6e-19299390499
                              E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                       B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                              vl ps+  + ++++lp  fae++ +g++     ++l++ +g++W v++ yr+++    l++GW eF  +n+L egD++vF+l +++
  mrna31955.1-v1.0-hybrid 299 VLRPSYLYRGCIMYLPSCFAEKNlSGVSG---FIKLQSADGKQWPVRCLYRGGR--AKLSQGWYEFTVENNLLEGDVCVFELLKTK 379
                              78899******************866743...5***************665555..66************************9999 PP

                              EE..EEEEE-S CS
                       B3  89 efelvvkvfrk 99 
                              e  l+v vfr 
  mrna31955.1-v1.0-hybrid 380 EIVLKVNVFRV 390
                              99999999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.34E-21297IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.3E-22297IPR015300DNA-binding pseudobarrel domain
CDDcd100171.49E-18497No hitNo description
PROSITE profilePS5086314.395599IPR003340B3 DNA binding domain
SMARTSM010191.7E-14699IPR003340B3 DNA binding domain
PfamPF023628.5E-13797IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.1E-24289389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-23290390IPR015300DNA-binding pseudobarrel domain
CDDcd100176.32E-23294389No hitNo description
SMARTSM010192.8E-21296391IPR003340B3 DNA binding domain
PROSITE profilePS5086314.17296391IPR003340B3 DNA binding domain
PfamPF023621.5E-17299390IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MKRPYFEKLI LSSTLQAKQL KIPENFAKKF RDEFSTYVTL SVPGGHVWRI GLKKAAENKY  60
WFQDGWQDFI ERYSIRIGYF LIFRYEGNSS FIVNIFNLTT AEINYPPNAL SGTGGTVCSN  120
QYQVFEEMED EDSVEIMGSS PSSIVTNTMR DKLFGDVANQ LTPGKNYSPP SLQNLFNGAK  180
HNWTDAGKLH TPKVTGLQGN NSTQDNGTER KKSKKAVDEV KSCTPGEGTQ SDKKTVRKRR  240
KRDPNVQESS AQHEQDVEIR FRFYESASAR KRTVTAEERE RAVNLAKTFE PVNPFCRVVL  300
RPSYLYRGCI MYLPSCFAEK NLSGVSGFIK LQSADGKQWP VRCLYRGGRA KLSQGWYEFT  360
VENNLLEGDV CVFELLKTKE IVLKVNVFRV QEEDAGFVTQ SYGNQPSGQN IIQAIPLRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-7126239215144B3 domain-containing transcription factor VRN1
4i1k_B2e-7126239215144B3 domain-containing transcription factor VRN1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of vernalization. Acts as transcriptional repressor of FLC, a major target of the vernalization pathway. Binds DNA in vitro in a non-sequence-specific manner. {ECO:0000269|PubMed:12114624}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna31955.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290393.10.0PREDICTED: B3 domain-containing transcription factor VRN1
SwissprotQ8L3W11e-135VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A2P6PN020.0A0A2P6PN02_ROSCH; Putative transcription factor B3-Domain family
STRINGXP_004290393.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-135B3 family protein
Publications ? help Back to Top
  1. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]
  2. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]