PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31899.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 396aa    MW: 44255.5 Da    PI: 7.8335
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31899.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33257312156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  mrna31899.1-v1.0-hybrid 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 312
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-30254315IPR009057Homeodomain-like
PROSITE profilePS5129414.318254314IPR017930Myb domain
SuperFamilySSF466892.19E-18254315IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-27257312IPR006447Myb domain, plants
PfamPF002496.1E-8259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGSVPPELSL DFRPSFVPKT ITDFLKEVSL IGNVTERLSK LDNFVKRLEE EMRKIDAFKR  60
ELPLCMFLLN DAIQALKEDA MQCAKPNVQP VLEEFIPLKK DCDKKTGEPN NHKKEKDSRD  120
KKNWMSSVQL WNTDNYHHPT SDFPCDRKQG SDIDSKRNEA RNGVANEDPF QTCRDRNGGR  180
AFVPFKAYPA FSVPAVKEDK EDLAVHGLSL LTPGIKNPKE ESASSGSRST CGRAVSFSAA  240
NVQSNMRISP QQPTSRKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE LMQVDGLTND  300
EVKSHLQKYR LHTRRVPAAK SAPANQSVVV LGDLWTSPDQ YDHSSKANSS QSGSPQGPLQ  360
LAENGGDDED SDEDDAKSES YSWKGHIHKP GKDDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna31899.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458328.10.0PREDICTED: uncharacterized protein LOC101303079
TrEMBLA0A2P6PMS80.0A0A2P6PMS8_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004290315.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.18e-59G2-like family protein