PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31621.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 363aa    MW: 40736.3 Da    PI: 6.8038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31621.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.7e-1175113240
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLea 40 
                              + +k++rr+++NReAAr+sR RKka++++Le+   +L +
  mrna31621.1-v1.0-hybrid  75 PTDKVQRRLAQNREAARKSRMRKKAYVQQLETSRLKLVQ 113
                              579****************************86555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.4E-970121No hitNo description
SMARTSM003389.9E-874134IPR004827Basic-leucine zipper domain
PfamPF001703.2E-876116IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9976118IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-778116No hitNo description
CDDcd147086.09E-2178130No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
PfamPF141443.4E-30164239IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNSHSTQFVT SRRMSAYEPI HQMSMWGESF MDNGSLNASA SLIMDADTKL DNQSEDTSQG  60
LLGPSSKYDQ EATKPTDKVQ RRLAQNREAA RKSRMRKKAY VQQLETSRLK LVQLEQELDR  120
ARQQGLYIGS GLDANPLGYS GSMNSGVAAF EMEYGHWVDE QNRQISELRT ALQAQISDIE  180
LRFLVDGGMS HYFELFSMKS KAAKADVFYV MSGMWKTSAE RFFSWIGGFR PSELLKVLLP  240
QLCPLADQQL LDVSSLKQSC QQAEDALSQG MDKLQLTLAS AVAADHPGEG IYVPQMAIAM  300
EKLEALVDFV NQADHLRKET LQQMSRILTI RQAARGLLAL GEYFQRLRAL SSLWTTRPRE  360
PT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466109.10.0PREDICTED: transcription factor TGA4-like isoform X1
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLM5WIH40.0M5WIH4_PRUPE; Uncharacterized protein
STRINGGLYMA18G02430.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109634104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein