PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31322.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 352aa    MW: 39638.4 Da    PI: 6.5294
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31322.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-116293334
                             XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeek 34
                             ++k++rr+++NReAAr+sR RKka++++Le+ 
  mrna31322.1-v1.0-hybrid 62 ADKVQRRLEQNREAARKSRMRKKAYVQQLETS 93
                             79***************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-660149IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.78362104IPR004827Basic-leucine zipper domain
PfamPF001705.8E-86295IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-864106No hitNo description
SuperFamilySSF579591.31E-76497No hitNo description
PROSITE patternPS0003606782IPR004827Basic-leucine zipper domain
PfamPF141448.7E-28153225IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGIYEPFRQV GVWRETFSGG NSSNIGASTI VEVDSRIDNK IGFGSPEPMG PSGNDQESNR  60
SADKVQRRLE QNREAARKSR MRKKAYVQQL ETSRFKLAQL ELELDRTRKQ AAYGGSSFGG  120
SHMGYNGIVS SGITTFELEY GHWVEEQHRQ NIELRNALQE HATEIELRIL VEGGLNHYAT  180
LFRMKADAAK ADIFYLLSGI WRTSVERYFH WIGGFRPSEL LNILESQLEP LTEPQSLDFY  240
NLKQSSQQAE DALSQGMDKL QQTLAKTLEA DQILSGETYG SQMAAAIEKF EALESFVSQA  300
DHLRQQTLQQ MSRILTTHQA ARGLLALGEY FQRLRALSSL WTARPREPPA A*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300665.10.0PREDICTED: transcription factor TGA7-like isoform X1
RefseqXP_011465538.10.0PREDICTED: transcription factor TGA7-like isoform X2
SwissprotQ93ZE21e-148TGA7_ARATH; Transcription factor TGA7
TrEMBLM5XP460.0M5XP46_PRUPE; Uncharacterized protein
STRINGVIT_18s0001g04470.t011e-175(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109634104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-150bZIP family protein