PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31321.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 472aa    MW: 52672.4 Da    PI: 8.4937
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31321.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.4e-15400443548
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                              +r++r++kNRe+A rsR+RK+a++ +Le kv  Le+ N+ Lkk+
  mrna31321.1-v1.0-hybrid 400 RRQKRMIKNRESAARSRARKQAYTNQLESKVSHLEKMNTWLKKQ 443
                              69*************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-10396455IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.346398443IPR004827Basic-leucine zipper domain
PfamPF001705.3E-13400443IPR004827Basic-leucine zipper domain
CDDcd147071.35E-21400445No hitNo description
Gene3DG3DSA:1.20.5.1709.6E-14400444No hitNo description
SuperFamilySSF579591.63E-10400445No hitNo description
PROSITE patternPS000360403418IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MDPTILEQCP STVTVRRNPH RRARPLTTPA TTAAGIPTPS CTVPKVPFPM EEILSMDIFN  60
SKPDPENFRN VWPQNPRNAA REQQKKKKSP SAEVCVKVNS ARSVMVSPPL ALQEPNRLKS  120
EVYNGFSHVG FGRVHMDDRT LVSGNGDEKP QFPPLAGQGS NYNLTLDRNE VESNLGNMSK  180
PLNTRMAHLD EFLKNVISVD QEVQLLQHAS SSCSSLPTSL FLGNFNLNGP LMSTTKKKIT  240
IDEVWKEIAH HDHHSLNLNS AAAHDSLHHQ RMTTIGEPTT ETTPPEHLLV RAGILNAHQM  300
MPIDPEAVVS QQADWFQFQV AAAAAAQQMT MLDSNFTVCE SVFENSSSAM NLDNFSENHQ  360
VGMSIPLPEI SAASSSESQA THAERKRNYS DEMKEKSIER RQKRMIKNRE SAARSRARKQ  420
AYTNQLESKV SHLEKMNTWL KKQKEVEILL SSNPTNSMPT YQLRRTSSAS F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301946.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLM5Y2K01e-118M5Y2K0_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.16e-27ABA-responsive element binding protein 3