PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31174.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Whirly
Protein Properties Length: 667aa    MW: 75399.6 Da    PI: 10.5528
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31174.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly643e-20522583162
                   Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatev 62 
                              s+yk+kaal++ +++ptf++l++g+++++r+G+++l++++a++erkyd ekkq++ ls++ v
  mrna31174.1-v1.0-hybrid 522 SIYKGKAALSLSPILPTFTKLETGSVVVERRGSVMLKFMPAIGERKYDSEKKQRLGLSSAWV 583
                              79*******************************************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.3E-23511583IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.26E-36515645IPR009044ssDNA-binding transcriptional regulator
PfamPF085364.9E-19523585IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.103.2E-14596644IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MNHYSWGRPA LRYVQTRRRT QAAEMYQKGT CFFDRGKYDC RALSSFCPLA YWDRWRSSTM  60
LSMVEHFTAT SSSSSFRSLS GNHKMIYKKG DRIRTYGRSQ LVYKIEWPQD SRFDCFPRML  120
LSRSPFDPGE CTMATFRPIN FSVPLVGWAS AVFRPDIPLK IPTGLSRMRR LSLRALAYYS  180
RQKAQQPNCP EQNQHSSQFI VGIESRFQRL RQYGKPEREY LGCKAREDGT PLRLTKEKIN  240
GRGVRGTGED GWIIDQVQDS SKMDLPSYLR VRPRNSFVQS ISRLLKKSIS VVSYFTWSSS  300
YFASVPKAKS SSASTQSAIP FLFLQEIVLS ACVLNITYFW GHEDRPLFSV TTCRGKTARI  360
PAGMSGYGPA LATATRWTLC FGASPLLRSM GRTRGDHPEN LHLLRGIHSR EQTQPASRAN  420
PNHYSHETAS DDGVESLRKV RGLNMMQLLR VFSSSSSRAE NVNQLSLFSP VVLALWEVLM  480
NQLSKRAASS LDAFTQSTGF STARQNFSAK GRIGNQIYAP FSIYKGKAAL SLSPILPTFT  540
KLETGSVVVE RRGSVMLKFM PAIGERKYDS EKKQRLGLSS AWVPKILVNC FMILQCNQAV  600
VNNLLKTRES FSVPVTTAEF AVMKAACSFA LPHIIGWDRL TNKVPRGVEV QKSEMVEPQL  660
LDEWER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_D9e-3751664410170Single-stranded DNA-binding protein WHY2, mit
4kop_C9e-3751664410170Single-stranded DNA-binding protein WHY2, mit
4kop_B9e-3751664410170Single-stranded DNA-binding protein WHY2, mit
4kop_A9e-3751664410170Single-stranded DNA-binding protein WHY2, mit
3n1l_A1e-365116435169protein StWhy2
3n1k_A1e-365116435169protein StWhy2
3n1j_A1e-365116435169Protein StWhy2
3n1i_A1e-365116435169protein StWhy2
3n1h_A1e-365116435169StWhy2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU3635341e-118GU363534.1 Fragaria vesca subsp. americana isolate mt67326 mitochondrial sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-41WHIRLY 2