PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30953.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 470aa    MW: 51530.9 Da    PI: 7.6107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30953.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31259314156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  mrna30953.1-v1.0-hybrid 259 KARRCWSPDLHRRFVSALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 314
                              68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1256316IPR017930Myb domain
SuperFamilySSF466899.68E-17257317IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28257317IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-26259314IPR006447Myb domain, plants
PfamPF002491.3E-6261312IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MGAASPSELT LECKPHSYSM LLKSFGDHHH QAASTTQNHD LKQLEEILSR LEEERLKIDA  60
FKRELPLSMQ LLTTAVEASR QQLQAYRSSS ANNQGPIRPV LEEFIPLKHS NSEGPEKQTN  120
SSDKANWMTS VQLWSQADAT KPKEQGDMGF NVSPKLALDT KQQRSYGGGA FHPFSKDIRN  180
SGPSPNLQPL PELALGSPEN NTGQNMDQDK KCSELGENGI NLGVVSTTQD QQGKTTEGQT  240
STITTTNTNT STQNSSHRKA RRCWSPDLHR RFVSALQMLG GSQVATPKQI RELMKVDGLT  300
NDEVKSHLQK YRLHTRRPSP SPQAAGGPTP QLVVLGGIWV PPEYATGGHN GPTALYSPAS  360
HAPTHYCATP MPQDFYTTAQ QPPQSGHHQL HHHTLHHQLH VYRAGTTSRT QSSPESDLRG  420
NGDRSESIED GKSESGSWKA GTESGEKGMA SRRSEDREES NGSQITLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13259312154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13259312154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13259312154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13259312154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna30953.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288823.10.0PREDICTED: uncharacterized protein LOC101303940
SwissprotQ9ZQ851e-119EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A2P6RJ770.0A0A2P6RJ77_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004288823.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]