PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30750.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LFY
Protein Properties Length: 378aa    MW: 42288.6 Da    PI: 8.5433
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30750.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY507.94.8e-1552236443386
                  FLO_LFY  43 aaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekk 128
                              +aa   r lee+f+ayGvr + +ak+a+lGftvstL++mkdeeldd+m+s+s++ r++llvGeryGikaavra+rrr  eee    
  mrna30750.1-v1.0-hybrid  22 TAAGYSRALEEMFRAYGVRSYVAAKMADLGFTVSTLLEMKDEELDDMMNSVSQVSRVELLVGERYGIKAAVRAQRRRRLEEE---- 103
                              22333689******************************************************************99988866.... PP

                  FLO_LFY 129 rrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeed 214
                               r+ ls d+  ++d+lsqeglseepvq eke++gsgge ++e  + aa+     ++k++ ++ ++   ++++ ++  d+de+ee++
  mrna30750.1-v1.0-hybrid 104 PRHALSGDT-VVIDSLSQEGLSEEPVQLEKEMVGSGGEAACEG-VRAAK-----KRKRELRRIRRGGGHRSS-NEGVDDDENEENE 181
                              344689996.58***********************99994433.33332.....222222221222222222.2223333333333 PP

                  FLO_LFY 215 edeeg...........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfrya 289
                              +  +g           ++ +g++rqrehPfivte+gev rgk nGLDYLf+Ly +C++fL+qvqkiak+rGekcPtk+tn+vfrya
  mrna30750.1-v1.0-hybrid 182 DGINGgggeqpsralaKRGGGRKRQREHPFIVTEAGEVVRGKSNGLDYLFHLYKECHQFLTQVQKIAKKRGEKCPTKMTNKVFRYA 267
                              3322235677888887777788**************************************************************** PP

                  FLO_LFY 290 kkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLr 375
                              k+ ga++inkPkmrhYvhCYalhcLdee snalrr+ k rg+n+Gaw qacy+ +v+iaa +gwdida+f++hp+Ls+WYvPtkLr
  mrna30750.1-v1.0-hybrid 268 KEEGANHINKPKMRHYVHCYALHCLDEERSNALRRECKLRGDNIGAWMQACYRSVVEIAAPRGWDIDAIFSEHPQLSVWYVPTKLR 353
                              ************************************************************************************** PP

                  FLO_LFY 376 qLChlerskas 386
                              qLCh+er++a+
  mrna30750.1-v1.0-hybrid 354 QLCHAERNNAT 364
                              ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016983.2E-1501363IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDPDASTATL FKWDLRFAPQ QTAAGYSRAL EEMFRAYGVR SYVAAKMADL GFTVSTLLEM  60
KDEELDDMMN SVSQVSRVEL LVGERYGIKA AVRAQRRRRL EEEPRHALSG DTVVIDSLSQ  120
EGLSEEPVQL EKEMVGSGGE AACEGVRAAK KRKRELRRIR RGGGHRSSNE GVDDDENEEN  180
EDGINGGGGE QPSRALAKRG GGRKRQREHP FIVTEAGEVV RGKSNGLDYL FHLYKECHQF  240
LTQVQKIAKK RGEKCPTKMT NKVFRYAKEE GANHINKPKM RHYVHCYALH CLDEERSNAL  300
RRECKLRGDN IGAWMQACYR SVVEIAAPRG WDIDAIFSEH PQLSVWYVPT KLRQLCHAER  360
NNATASSSAS GGKDTAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-912023622162PROTEIN LEAFY
2vy2_A2e-912023622162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna30750.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7882600.0JN788260.1 Fragaria x ananassa LEAFY like protein 2 (LFY-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460336.10.0PREDICTED: protein UNIFOLIATA-like
SwissprotO040641e-148FLLH_POPTR; Floricaula/leafy homolog
SwissprotO485591e-148UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A184XYZ30.0A0A184XYZ3_FRAAN; LEAFY-like protein 1
STRINGXP_004300371.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-90floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]