PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30482.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 253aa    MW: 28882.9 Da    PI: 8.3211
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30482.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.31.6e-101922262155
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              k +yps++++  LA+++gL+++q+k+WF N+R ++
  mrna30482.1-v1.0-hybrid 192 KWPYPSESQKLALAESTGLDQKQIKNWFVNQRVRH 226
                              569*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012563.2E-1456108IPR005541KNOX2
PfamPF037911.6E-1660103IPR005541KNOX2
PROSITE profilePS512139.219145165IPR005539ELK domain
PROSITE profilePS5007113.216166229IPR001356Homeobox domain
SuperFamilySSF466892.82E-19168237IPR009057Homeodomain-like
SMARTSM003894.5E-12168233IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-26171231IPR009057Homeodomain-like
CDDcd000869.81E-12176230No hitNo description
PfamPF059204.3E-16186225IPR008422Homeobox KN domain
PROSITE patternPS000270204227IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MMVFLDLRVL NCFEMRKLKQ VGAPPDVLGR LEEACESAAK IGHMVRRQRS SGNGHGHGSL  60
GEDPTLDQFI EAYCEMLIKY EQDVSKSFKE AMLFLHKIES QFKAALTVSS AGCGEGGMDR  120
NINGSSEEED VNNNLSVDPQ VEDRKLKGQL LREYRGNLGS LKQELKLKKR RKGKLPDEAR  180
QQLFDWWNRH YKWPYPSESQ KLALAESTGL DQKQIKNWFV NQRVRHWKPW ENMQIIAAMD  240
ASNNMDVSPS LL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164170LKLKKRR
2167171KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460018.11e-108PREDICTED: homeobox protein SHOOT MERISTEMLESS isoform X2
SwissprotQ9M6D91e-86STM_BRAOL; Homeobox protein SHOOT MERISTEMLESS
TrEMBLQ8GUC41e-97Q8GUC4_HELTU; Putative knotted-1-like protein
STRINGVIT_10s0116g00190.t016e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.15e-78KNOX/ELK homeobox transcription factor