PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30337.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 213aa    MW: 22711.9 Da    PI: 6.3539
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30337.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.71.3e-153191257
                             T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             r+R+ +++eq+ +Le+ F++   +p +ee  ++ k l    ++ +++V++WFqNrR + ++
  mrna30337.1-v1.0-hybrid 31 RSRWIPKPEQILILESIFNSgMVNPPKEETVRIRKLLekfgSVGDANVFYWFQNRRSRSRR 91
                             89*****************99*************************************997 PP

2Wus_type_Homeobox105.33.8e-343093265
        Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                             +r+RW P+peQi iLe++++sG+++P+kee+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
  mrna30337.1-v1.0-hybrid 30 VRSRWIPKPEQILILESIFNSGMVNPPKEETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQ 93
                             589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-81492IPR009057Homeodomain-like
SuperFamilySSF466893.64E-142498IPR009057Homeodomain-like
PROSITE profilePS5007111.2722792IPR001356Homeobox domain
SMARTSM003892.8E-62996IPR001356Homeobox domain
PfamPF000462.2E-133191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MEDHQGQAGG GQEAKEPNSH SSSEKSTEPV RSRWIPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKLLEKF GSVGDANVFY WFQNRRSRSR RRQRQLQASL EQRNQLAAAD QQVGGAIQYG  120
SCSSATSFSA PPSPPPPAAA MAFGASTPST FVSNYDLVGG SSSSSCAPMA ADDHFFSVSG  180
QMGFPEIEQH SSSGETSALG PSDASSLHFQ SG*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna30337.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289578.21e-153PREDICTED: WUSCHEL-related homeobox 11
SwissprotQ8GY251e-37WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLA0A2P6RHC61e-109A0A2P6RHC6_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004289578.11e-153(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-35WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]