PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna30280.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 438aa    MW: 47924.5 Da    PI: 8.3766
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna30280.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-14352400553
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                              +r+rr++kNRe+A rsR+RK+a++ eLe +  +L +eN  Lk+ l el+
  mrna30280.1-v1.0-hybrid 352 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENANLKQALTELE 400
                              79****************************************9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-11348413IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.415350400IPR004827Basic-leucine zipper domain
PfamPF001708.3E-12352403IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.9E-14352404No hitNo description
CDDcd147071.30E-22352406No hitNo description
SuperFamilySSF579596.88E-11352399No hitNo description
PROSITE patternPS000360355370IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MGGVSESETM SHSREESPLQ SDQHAKNNQL FTSLGRESSI YSLTLDEFQH TLCENGKNFG  60
SMNMDEFLNS IWTAEENQAI NSTHHNNNNN LNANHINNIS SSNVQHHASS EVSTEKKGMI  120
ARQPSLARQG SLTLPAPLCR KTVDEVWSEI HRGQKAQAQQ LNNNHNDSND GAQNSEYAAR  180
QPTFGEMTLE DFLVKAGVVR EPDSMSVAPL PPQPQQQPQQ YGVVGQSFMM GMGANAGAST  240
STTPVLPNYQ TIPQGGAPVG ESPGYATNGK RNGVYLPPPS QAVCFGGRMV NGGGGYAPTQ  300
PIGMAAPLSP VSSDGMCASQ IENSGGQHGM GMGALRGRKR IIDGPVEKVV ERRQRRMIKN  360
RESAARSRAR KQAYTVELEA ELNQLREENA NLKQALTELE MKRKQQHCEE MRKRVQSRAQ  420
KAMEKLWMLK RSHSCAV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1285293GGRMVNGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466768.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2
RefseqXP_011466769.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5 isoform X2
SwissprotQ9SJN01e-117ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLM5WCL30.0M5WCL3_PRUPE; Uncharacterized protein
STRINGSolyc09g009490.2.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-116bZIP family protein