PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29786.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 635aa    MW: 70178.4 Da    PI: 8.2451
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29786.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.83.3e-1758118257
                              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              ++R+++ +eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  mrna29786.1-v1.0-hybrid  58 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 118
                              89*****************99*************************************995 PP

2Wus_type_Homeobox110.59.3e-3657119264
        Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                              +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  mrna29786.1-v1.0-hybrid  57 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 119
                              689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-645117IPR009057Homeodomain-like
PROSITE profilePS5007110.36554119IPR001356Homeobox domain
SuperFamilySSF466892.05E-1155123IPR009057Homeodomain-like
SMARTSM003891.9E-856123IPR001356Homeobox domain
CDDcd000861.25E-757119No hitNo description
PfamPF000468.0E-1558118IPR001356Homeobox domain
Gene3DG3DSA:3.40.50.3002.4E-71423604IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS5141935.761426632No hitNo description
SuperFamilySSF525408.7E-59426597IPR027417P-loop containing nucleoside triphosphate hydrolase
CDDcd018681.49E-128428592No hitNo description
SMARTSM001734.2E-30428594No hitNo description
TIGRFAMsTIGR002319.0E-40429587IPR005225Small GTP-binding protein domain
PRINTSPR004498.6E-40431452No hitNo description
SMARTSM001753.7E-112431594No hitNo description
PfamPF000712.8E-61432592IPR001806Small GTPase superfamily
SMARTSM001741.4E-12433590No hitNo description
SMARTSM001761.4E-6436625No hitNo description
PRINTSPR004498.6E-40454470No hitNo description
PRINTSPR004498.6E-40472494No hitNo description
PRINTSPR004498.6E-40534547No hitNo description
PRINTSPR004498.6E-40569591No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0003677Molecular FunctionDNA binding
GO:0005525Molecular FunctionGTP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPTHHQ WQHDATLVPN GSCHRPPYGT TTATTSSGLE DQRTPEPKPR  60
WNPRPEQIRI LEAIFNSGMV NPPRDEIRKI RAQLQEYGQV GDANVFYWFQ NRKSRSKHKL  120
RLQHINSKQQ QQSHKASLTA GPSSSSSSSE RSSPNKQQQQ QSNKTSFSMG FSSPPHVVTT  180
HDVCNINSPT ASVNQTSFFH ALPNPEVLHP EPAYFFPVNS PAASTNGPVA SANFSTTQGF  240
YFSELANVVH VNNSADLHTG LLLSEIMNNN GMAPRKNDRD QEMNKGMKMA DQQQLQLNYN  300
STVTTSPTTT GGVNVAVPSP ITHFQGIGEA GAAIMGAGGA ARSMVFINDV AFEVAAGPFN  360
VREAFGDDAV LIHSSGHPVL TNEWGVTLHS LHHGAFYYLK KQRKTETFEN PFYRNCPMGA  420
YRADDDYDYL FKVVLIGDSG VGKSNLLSRF TRNEFSLESK STIGVEFATR SIRVDDKVVK  480
AQIWDTAGQE RYRAITSAYY RGAVGALLVY DVTRHVTFEN VERWLKELRD HTDANIVIML  540
VGNKGDLRHL RAVSTEDAQA FAERENTFFM ETSALESMNV DNAFTEVLSQ IYRVVSRKAL  600
DIGDDPAALP KGQTINVGGK DDVSAVKKVG CCSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fbl_B1e-9842463410220Ras-related protein Rab-11A
5fbq_B1e-9842463410220Ras-related protein Rab-11A
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29786.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295563.20.0PREDICTED: WUSCHEL-related homeobox 9
TrEMBLA0A498IVT40.0A0A498IVT4_MALDO; Uncharacterized protein
STRINGXP_004295563.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.13e-47WUSCHEL related homeobox 8