PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29778.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family VOZ
Protein Properties Length: 563aa    MW: 62660.7 Da    PI: 7.9827
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29778.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ443.62.4e-1362814971217
                      VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaata 86 
                              pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkdgllfaalsak+qgk+vgipecegaata
  mrna29778.1-v1.0-hybrid 281 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMAPVLRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATA 366
                              89************************************************************************************ PP

                      VOZ  87 kspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyey 172
                              kspwna+elfdl +lege +rewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp++ fewhlyey
  mrna29778.1-v1.0-hybrid 367 KSPWNAPELFDLYVLEGEMLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEFGGLKRSYYMDPQPLNLFEWHLYEY 452
                              ************************************************************************************** PP

                      VOZ 173 eineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                              ei+++da+alyrlelklvd+kks+kgk+s+ds+adlqk++grl+a
  mrna29778.1-v1.0-hybrid 453 EISKCDACALYRLELKLVDGKKSSKGKLSNDSVADLQKQMGRLSA 497
                              *******************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MLYFHVMLPI VTLPAYTSRS FHSQHRKRAK DKSVTASSST LHQATKPVSP LWKLESYTLS  60
KQGFKVKRGR VFVMRKGSKS NCKSVSHKLF KDKAKNRVDD LQGMFMDLQF ARKESRTIDA  120
TLLEEQVHQM LREWKSELNE TSPASSFQQG GSVGSFSSDI CRLLQLCEEE DDASSPLAAP  180
KPEPNDQKLD TGESLVFQEG FSVNHGQQEH SFPMADQCKS SLLGVRSAGV NNLQGVNQLD  240
YHQLDLRQSF DHNYYTCFNG TALSVEDDLS HATSYLPSIC PPPSAFLGPK CALWDCPRPA  300
QGLDWCQDYC SSFHAALALN EGPPGMAPVL RPGGIGLKDG LLFAALSAKA QGKDVGIPEC  360
EGAATAKSPW NAPELFDLYV LEGEMLREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES  420
RKQVMNEFGG LKRSYYMDPQ PLNLFEWHLY EYEISKCDAC ALYRLELKLV DGKKSSKGKL  480
SNDSVADLQK QMGRLSAEFP SDNKRNVKGR AKVNAKVGVG TVYYTPSQGT ATNGTSTNGT  540
FDYGTGPPYD YVVDNLSGYY LT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29778.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293908.20.0PREDICTED: transcription factor VOZ1 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2P6Q4C30.0A0A2P6Q4C3_ROSCH; Putative transcription factor VOZ family
STRINGXP_004293908.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]