PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29726.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 158aa    MW: 17887.7 Da    PI: 7.8446
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29726.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.71.5e-4277153278
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              Cq+++C+adls+ak+y+rrhkvC++hskapvv++ gl+qrfCqqCsrfh+lsefDe+krsCrrrLa+hnerrrk+++
  mrna29726.1-v1.0-hybrid  77 CQAQSCNADLSDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQCSRFHDLSEFDENKRSCRRRLAGHNERRRKNSS 153
                              **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375754.9E-571157IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.103.1E-3570138IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.1274151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3975154IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3277150IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MEPNKAQGKR SLNLDIEEEE EEEEADEDED HTSRPSVLVH GEDDRRKRVM VMNSASATSP  60
SKKGSAAGGS MTTRPSCQAQ SCNADLSDAK QYYRRHKVCD FHSKAPVVVI GGLRQRFCQQ  120
CSRFHDLSEF DENKRSCRRR LAGHNERRRK NSSDYPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-34771501184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29726.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293885.11e-114PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387416e-45SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2P6Q4831e-83A0A2P6Q483_ROSCH; Squamosa promoter-binding-like protein
STRINGXP_004293885.11e-113(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-41squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]