PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29677.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 293aa    MW: 33496 Da    PI: 6.0199
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29677.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.41e-20108152246
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                              prlrWtp+LH +F++a+e LGG+e+AtPk +l+lm+v gL+++h+
  mrna29677.1-v1.0-hybrid 108 PRLRWTPQLHLSFLHALELLGGQERATPKLVLQLMNVRGLSISHM 152
                              8*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-17104152IPR009057Homeodomain-like
SuperFamilySSF466892.15E-7107151IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-13108151IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MRNELELIGD LGDQKRKTDK ISEEQAENIS VESSQKCSSF DLNEDVSDNS DNDNSNYTSV  60
TNLADHEPSS VRNDERRALA QENMNNAANI ISNSSRAKVR PYVRSKLPRL RWTPQLHLSF  120
LHALELLGGQ ERATPKLVLQ LMNVRGLSIS HMYRSKKLDG DGQVVSVKTY DYMDGRESRD  180
HIPNFVPSLE GHSNSGSHKQ ECEPPFRLEW NKEKISKYKE WMPHLELGLQ SQRVGKEISD  240
ETHQHHQTVS HEEERYEIAE GVIETSQHCK DHQFEDMNSK QETISTKLSL SL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29677.1-v1.0-hybrid
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460614.11e-121PREDICTED: two-component response regulator ARR12-like isoform X2
TrEMBLA0A2P6Q4Q87e-71A0A2P6Q4Q8_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004293956.11e-120(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-23G2-like family protein