PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29149.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 1072aa    MW: 118589 Da    PI: 8.3115
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29149.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.32.8e-40151228178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  mrna29149.1-v1.0-hybrid 151 MCQVDDCKEDLSTAKDYHRRHKVCESHSKSTKALVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 228
                              6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-34145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.53149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-36150230IPR004333Transcription factor, SBP-box
PfamPF031101.5E-29152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.38E-5826958IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.0E-5833961IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.985902969IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.897902925IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1072 aa     Download sequence    Send to blast
MEEIGAQVAT PIFLRQSLSS RFCDPPAAMA KKKRDLPYQA PNYQHPNSQT LFGNPGSNSW  60
NPNVWDWDAV RFVARPLDTE MMGASNSEPR RKEEAAGGAV KSTAVAVEDE DERLQLNLGG  120
GLASVEEPAV SRPNKRVRSG SPGNNGGSYP MCQVDDCKED LSTAKDYHRR HKVCESHSKS  180
TKALVAKQMQ RFCQQCSRFH PLSEFDEGKR SCRRRLAGHN RRRRKTQPED VTSRLTIPGD  240
GDNKTSGNLD IVSLLAAITR PQGKTDVRNT NSSSVLDREQ LLQILSKINS LPLPVDLAAK  300
LPNLGNLNWK ASDLLPLDLQ NKLNGKTSVS TLDLITVLSA TLATPSDTLA ILSQKSSQSS  360
DSEKTKLTCS DQERPNLQKR SPQEFHSAGG ERSSTSYQSP AEDSDCQVQE TRVKLPLQLF  420
SSSPEDDSPP KLASSRKYFS SDSSNRTEER SPSSSPPVMQ TLFPMKSMAE TVKSEKQSIS  480
KECNLNLDYS LNGGSNLPFD LFRGSNRGAV SSSIQNFPHQ AGYTSSGSDH SPSSLNSDPQ  540
DRTGRILFKL FDKDPSQLPG TLRTQVYSWL SNSPSEMESH IRPGCVVLSV YVSMPFAAWE  600
HLEENLVQHV SSLVQSSDSD FWRSGRFLVN TGRQLASHKD GKIRLCKAWR SYSSPELISV  660
SPLAVVGGQQ TSLSIRGRNL TNHGTKIHCT YKGGYTSKEV GTTYHGTAYD EINLGSFQIL  720
DASPGVLGRC FIEVENGFKG NSFPVIIADA TICRELNLIE SEFDSERKVC GAISEDENHD  780
YGRPRSREEV LHFLNELGWL FQRKRISSMF QGSGYSLSRF KFLLTFSVER DFCTVVKTLL  840
DILVNFDGDG LSRESLGMLS DVQLLNRAVK RRCRKMIDLL INYSVISSDK KYIFPPNHAG  900
PGGLTPLHLA ASMSNSEDMI DALMNDPEEI GLSCWNSLLD GNGQSPYAYA MMRNNYSYNN  960
LVARKLTDKR NSQVTLTIGN EIEQTHMGIE LERRRSIQLR QGSRSCAKCA LAATKYTRRV  1020
PGAQGLLQRP FIHSMLAIAA VCVCVCLFLR GSPDIGSVAP FKWENLDFGT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29140225184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1866871RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna29149.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300082.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2P6PC020.0A0A2P6PC02_ROSCH; Putative transcription factor SBP family
STRINGXP_004300082.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]