PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28935.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 311aa    MW: 34222.1 Da    PI: 6.8015
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28935.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.24.9e-1754114257
                              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              ++R+ + +eq+ +Le+ F++   +ps+ee + ++++l    ++ +++V++WFqNr+ + k+
  mrna28935.1-v1.0-hybrid  54 KRRWIPRPEQIGILEAIFNSgMVNPSREEVRMITAQLqeygQVVDANVFYWFQNRKSRSKH 114
                              89*****************99*************************************995 PP

2Wus_type_Homeobox104.66.4e-3453116265
        Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                              ++ RW P+peQi iLe++++sG+++P++ee++ ita+L+eyG++ d+NVfyWFQNrk+R+++k+
  mrna28935.1-v1.0-hybrid  53 PKRRWIPRPEQIGILEAIFNSGMVNPSREEVRMITAQLQEYGQVVDANVFYWFQNRKSRSKHKH 116
                              579**********************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.45E-1250121IPR009057Homeodomain-like
PROSITE profilePS5007110.96550115IPR001356Homeobox domain
SMARTSM003892.8E-852119IPR001356Homeobox domain
CDDcd000862.19E-753116No hitNo description
Gene3DG3DSA:1.10.10.602.1E-753123IPR009057Homeodomain-like
PfamPF000468.0E-1554114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MASSNRHWPN MFKSKPTHQY RWQHDAVNPS LVPNGYSTAT TSSGLEDEMT PEPKRRWIPR  60
PEQIGILEAI FNSGMVNPSR EEVRMITAQL QEYGQVVDAN VFYWFQNRKS RSKHKHRRLQ  120
YSNKTQFSPP PPHDVCNLNS PTASSVNQTS FFPNPEVFPV NNPAASSSNG PVASADFSTT  180
QGFYFSELAN VVHGNNSPDL HHTGLLLSEI MNNNGMASPM STHFQVIGGE AGAAIMGAGG  240
AAAISTVFIN DVAFEVAEGP FNVREAFGDD AVLIHSSGHP VLTNEWGVTL HSLHHGAFYY  300
LQQLARVQQF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna28935.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460646.10.0PREDICTED: WUSCHEL-related homeobox 9-like isoform X1
RefseqXP_011460647.10.0PREDICTED: WUSCHEL-related homeobox 9-like isoform X1
TrEMBLA0A2P6Q4E71e-131A0A2P6Q4E7_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004295604.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.12e-34WUSCHEL related homeobox 8