PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28250.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 433aa    MW: 46987.6 Da    PI: 10.1648
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28250.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.9e-14354404555
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                              +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+  e+ ++
  mrna28250.1-v1.0-hybrid 354 RRQRRMIKNRESAARSRARKQAYTLELEAEVQKLKEMNEELQKKQAEIMEM 404
                              79****************************************998888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-12350415IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921352403IPR004827Basic-leucine zipper domain
PfamPF001701.7E-12354405IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-14354403No hitNo description
CDDcd147074.11E-24354408No hitNo description
SuperFamilySSF579591.19E-10354402No hitNo description
PROSITE patternPS000360357372IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGSNINFKNY GDVQNGDVNG GKLGGNFSLA RQTSVYSLTF DEFQNTMGGL GKDFGSMNMD  60
ELLKNIWSAE ETQGITSTSG AGEGNAPVGN LQRQGSLTLP RTLSQKTVDD VWKELNRESG  120
DVKFGNVGVG SDLPQEQRQQ TLGEMTLEEF LARAGVVRED AQEMARPSNS GFFGELFRHS  180
NNNTGLAPGF QQASRNNGLL GSRVESNNNS VPHQSPNLAL NVGGVRTSQQ QTHQLPPQQQ  240
PIFPKPATLS FAPSMHLVSN AQLTSPRSRG PMSAVVEPSR NTAFSQGGGF PGAGIGMGGL  300
GAGGVTVASR SPVNKISPDV IVKSSADTSS LSPIPYMFTR GRKANGALEK VVERRQRRMI  360
KNRESAARSR ARKQAYTLEL EAEVQKLKEM NEELQKKQAE IMEMQKDQIL ETMNREWGGK  420
RQCLRRTLTG PW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004294799.10.0PREDICTED: bZIP transcription factor TRAB1
RefseqXP_011461478.10.0PREDICTED: bZIP transcription factor TRAB1
SwissprotQ9M7Q21e-111AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLM5VW000.0M5VW00_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s10400.11e-171(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.21e-108abscisic acid responsive elements-binding factor 3