PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28202.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 388aa    MW: 43322.5 Da    PI: 6.8749
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28202.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.45.7e-442183171100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q
  mrna28202.1-v1.0-hybrid 218 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPLHQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQ 303
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              +++l+ +la++++e
  mrna28202.1-v1.0-hybrid 304 VSNLQMQLAVAQAE 317
                              *********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.776217318IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-43218315IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEVRSGLMQF MRSESLSVLR EISEKNVAEK LLVLEFLVRT FALVGDVESC LALRYEALVL  60
RDLKSTAQQW LKVPHLEWLN FAQQLLDNGF YSIGAKACEN ALRSLKGKSS EQSTADGVHL  120
ERISTEYPKT DEVLENEQVM EKIKRLKECA MSSASSHSAK YQSCSRERDT DGIQLAHFLG  180
FKDKKKCCFI PFTRLGGGQP ENDLFCNAAQ GEMGGTSPCA SCKLLRRRCA KDCIFAPYFP  240
SDDPHKFAIV HKVFGASNVS KMLQELPLHQ RGDAVSSLVY EANARVRDPV YGCVGAISFL  300
QNQVSNLQMQ LAVAQAEILC IQMQQEPVAA TLPASQMLDH HQYQDHDQKS LLLSNTHDFS  360
NIPQYLSSFG SSSNVIQDPL KRESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-79LBD family protein